DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and AT3G02300

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001327030.1 Gene:AT3G02300 / 821167 AraportID:AT3G02300 Length:482 Species:Arabidopsis thaliana


Alignment Length:430 Identity:103/430 - (23%)
Similarity:167/430 - (38%) Gaps:102/430 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 IFRSLGKNKGYSYEDDVG---GPGSDQLTAPVPAAAY---SNVSMELELPTAQTETKQLMIADTA 419
            :|.||   ||...:.|:|   |..:..::.|..:|.|   .|.|.:    |.:.|.::|:     
plant     1 MFSSL---KGEFLKMDIGEIIGEVAPSVSIPTKSAIYVWGYNQSGQ----TGRNEQEKLL----- 53

  Fly   420 APHEILEKRSVLYQLKAFGTCFSMAPIQLPPK---------AVIVDVAMSDSHFVVVNEDGSAYA 475
                                   ..|.||||:         :..:|::....|...|..|||.:|
plant    54 -----------------------RIPKQLPPELFGCPAGANSRWLDISCGREHTAAVASDGSLFA 95

  Fly   476 WGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVSACAGDGFTILVTQA----GSLLSCGSNAHL- 535
            ||...:|||| ...|..:.:|.:::.:::..|.....|...|..:.:.    |:|    |.:.| 
plant    96 WGANEYGQLG-DGTEVGRKHPKKVKQLQSEFVKFVSCGAFCTAAIAEPRENDGTL----STSRLW 155

  Fly   536 ALGQDEQRNYHSPKLI--ARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQ 598
            ..||::..|.  |:|.  |..|...:.||:.|..||:|||.||.:..||.:..|.||.|...:..
plant   156 VWGQNQGSNL--PRLFSGAFPATTAIRQVSCGTAHVVALSEEGLLQAWGYNEQGQLGRGVTCEGL 218

  Fly   599 KFPQKILLSHVK--------TKPSKIYCGPDTSAVLFANGELHVCGSNDYNKLGFQRSAKITAFK 655
            :.| :::.::.|        .|..::.||...:|.|...||::..|.....:||   ...:.:..
plant   219 QAP-RVINAYAKFLDEAPELVKIMQLSCGEYHTAALSDAGEVYTWGLGSMGQLG---HVSLQSGD 279

  Fly   656 KVQLPHKVT---------QACFSSTHSVFLVEGGYVYTMGRNAEGQRGIRHCN----SVDH---- 703
            |..:|.:|.         .|| ...|:..|...|.:|..|....||.|:...:    ||.:    
plant   280 KELIPRRVVGLDGVSMKEVAC-GGVHTCALSLEGALYAWGGGQAGQLGLGPQSGFFFSVSNGSEM 343

  Fly   704 -----PTLVDSVKSRYIVKANCSDQCTIVASEDNIITVWG 738
                 |.||.....|.:.   |....|:|...:..|..||
plant   344 LLRNVPVLVIPTDVRLVA---CGHSHTLVYMREGRICGWG 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 87/340 (26%)
AT3G02300NP_001327030.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.