DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and Nek7

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001189867.1 Gene:Nek7 / 820397 AraportID:AT3G12200 Length:581 Species:Arabidopsis thaliana


Alignment Length:264 Identity:83/264 - (31%)
Similarity:138/264 - (52%) Gaps:12/264 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LANYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVD----------VF 156
            |.||..|..|.:|......:.....:..:...|:|.|::.:...:..|:.|:.          :.
plant    16 LDNYHVVEQVRRGKSSSDFVVLHDIEDKKYAMKKICLAKHTDKLKQTALQEISRAVINYDLMKLL 80

  Fly   157 SKLHHPNIVSYLGSFI-KDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINY 220
            |.|.:|.||.|..|:| .||...|...|.:||.:|..|.:.:||| |||..|.....|:..|:||
plant    81 SSLKNPYIVHYEDSWIDNDNNACIFTAYYEGGNMANAIKKARGKL-FPEERIFKWLAQLLLAVNY 144

  Fly   221 MHSENILHRDLKTANVFLNRRGIVKIGDFGISKIMNTKIHAQTVLGTPYYFSPEMCEGKEYDNKS 285
            :||..::|.||..:|:||.:...|::|::|::|::|.:.....|.|......||:.|.:.|..||
plant   145 LHSNRVVHMDLTCSNIFLPKDDHVQLGNYGLAKLINPEKPVSMVSGISNSMCPEVLEDQPYGYKS 209

  Fly   286 DIWALGCILGEMCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTA 350
            |||:|||.:.|:...:..|.|.:::.|:.||.....:|:|..|:|.|:.::..:|:.:...||||
plant   210 DIWSLGCCMYEITAHQPAFKAPDMAGLINKINRSLMSPLPIVYSSTLKQMIKLMLRKKPEYRPTA 274

  Fly   351 SEVL 354
            .|:|
plant   275 CELL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 82/262 (31%)
S_TKc 105..354 CDD:214567 80/259 (31%)
ATS1 445..747 CDD:227511
Nek7NP_001189867.1 PKc_like 18..283 CDD:304357 82/262 (31%)
Pkinase 19..281 CDD:278497 81/261 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 177 1.000 Domainoid score I1076
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 1 1.000 - - mtm947
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X891
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.