DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and NEK11

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001308150.1 Gene:NEK11 / 79858 HGNCID:18593 Length:687 Species:Homo sapiens


Alignment Length:401 Identity:123/401 - (30%)
Similarity:182/401 - (45%) Gaps:91/401 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LANYEKVRV---------VGQGSFGIAILY--RRKSDGHQI-VFKQINLSELSPPGRDLAMNEVD 154
            ::.|.|..:         :|.||||...|.  ::...|.:: |.|:|::.||:|.....|..|..
Human    17 ISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVLKEISVGELNPNETVQANLEAQ 81

  Fly   155 VFSKLHHPNIVSYLGSFIKDNTLLIEMEYAD---------------------------------- 185
            :.|||.||.||.:..||::.:...|..||.:                                  
Human    82 LLSKLDHPAIVKFHASFVEQDNFCIITEYCEDLSKENCKPLLNEIKEDTNKWKNIPCSWVGRINI 146

  Fly   186 --------GGTLAQIIAE--RQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKTANVFLNR 240
                    |..|...|.|  :.||: |||..||..|.|:...::|||...|||||||:.|||| :
Human   147 VKMAILPKGRDLDDKIQEYKQAGKI-FPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFL-K 209

  Fly   241 RGIVKIGDFGISK-IMNTKIHAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCCLKKTF 304
            ..::||||||:|: :|.:...|.|:.|||:|.|||..:.:.||.|||||:|.|||.||||:...|
Human   210 NNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAF 274

  Fly   305 AASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVLVYWIPLIFRSLGKNK 369
            |.||...:|.||:.|:...:|..|...|.::|.::|......||:|.|:|.  ||.:        
Human   275 AGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILK--IPYL-------- 329

  Fly   370 GYSYEDDVGGPGSDQLTAPVPAAAYSNVSMELELPTAQTETKQLMIADTAAPHEILEKRSVLYQL 434
                        .:||...:  ..||.:::|.:....|.|...::.|        ::||..|..|
Human   330 ------------DEQLQNLM--CRYSEMTLEDKNLDCQKEAAHIINA--------MQKRIHLQTL 372

  Fly   435 KAFGTCFSMAP 445
            :|......|.|
Human   373 RALSEVQKMTP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 106/311 (34%)
S_TKc 105..354 CDD:214567 105/305 (34%)
ATS1 445..747 CDD:227511 1/1 (100%)
NEK11NP_001308150.1 STKc_Nek11 28..329 CDD:270861 106/304 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D132059at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.