DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and si:ch211-285c6.2

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_005160445.1 Gene:si:ch211-285c6.2 / 791193 ZFINID:ZDB-GENE-040724-168 Length:579 Species:Danio rerio


Alignment Length:260 Identity:80/260 - (30%)
Similarity:131/260 - (50%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 ILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLH--HPNIVSYLGSFIKD-NTLLIEM 181
            ||.:.:| |.|...|::.           |..|.||...||  ||:||.: ...|:| :.:.:.:
Zfish    22 ILAKNES-GDQFAVKKLR-----------AGQEKDVNFLLHLNHPHIVHH-KEIIRDGDCIYLVL 73

  Fly   182 EYADGGTLAQIIAER-QGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKTANVFLNRRGIVK 245
            :|.:...||:.|..: |....|.|:.|:....||..|:.|:|.:.|||:||:..::.....|.::
Zfish    74 DYFEAEDLAEKIKHKTQTAGQFSEKEILDWTVQICMALKYLHDQQILHKDLQPKSLLFTACGTIR 138

  Fly   246 IGDFGISKIMNTKIHAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCCLKKTFAASNLS 310
            :|:|. .|..:........|..   .:||:..||.|:.||:||.|||::.|||.|::.|::.|..
Zfish   139 LGEFD-KKFTDAPTAESESLAN---VAPEILSGKSYNKKSEIWRLGCVINEMCTLRRAFSSRNSD 199

  Fly   311 ELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVLVYWIPLIFRSLGKNKGYSYED 375
            |:|.||...:|..:|..::..|..|:.:.|||....||:.||:|..  |.|.:.|.|....:.|:
Zfish   200 EIVKKIRRSSYEHLPENFSEDLHELIKDTLQVRPADRPSVSEILKR--PFIIKHLNKMSKQTIEE 262

  Fly   376  375
            Zfish   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 75/242 (31%)
S_TKc 105..354 CDD:214567 74/237 (31%)
ATS1 445..747 CDD:227511
si:ch211-285c6.2XP_005160445.1 PKc_like 22..248 CDD:304357 76/244 (31%)
S_TKc 23..248 CDD:214567 75/243 (31%)
ApoL 262..474 CDD:283187 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.