DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and nek7

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001072574.1 Gene:nek7 / 780029 XenbaseID:XB-GENE-962512 Length:302 Species:Xenopus tropicalis


Alignment Length:261 Identity:98/261 - (37%)
Similarity:157/261 - (60%) Gaps:12/261 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LANYEKVRVVGQGSFGIAILYRRKS--DGHQIVFKQINLSEL-SPPGRDLAMNEVDVFSKLHHPN 163
            |||::..:::|:|.|  :.:||...  ||..:..|::.:.:| ....|...:.|:|:..:|:|||
 Frog    31 LANFQIGKMIGRGQF--SEVYRATCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPN 93

  Fly   164 IVSYLGSFIKDNTLLIEMEYADGGTLAQIIA--ERQGKLHFPERYIIAVFEQISSAINYMHSENI 226
            ::.|..|||:||.|.|.:|.||.|.|:::|.  ::|.:| .||:.:...|.|:.||:.:|||..:
 Frog    94 VIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRL-IPEKTVWKYFVQLCSALEHMHSRRV 157

  Fly   227 LHRDLKTANVFLNRRGIVKIGDFGISKIMNTK-IHAQTVLGTPYYFSPEMCEGKEYDNKSDIWAL 290
            :|||:|.||||:...|:||:||.|:.:..::| ..|.:::|||||.|||......|:.|||||:|
 Frog   158 MHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSL 222

  Fly   291 GCILGEMCCLKKTFAAS--NLSELVTKIMAGNYTPVPSG-YTSGLRSLMSNLLQVEAPRRPTASE 352
            ||:|.||..|:..|...  ||..|..||...:|.|:||. |:..||.|::..:..:..:||..:.
 Frog   223 GCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRMLVNTCINPDPEKRPDVTY 287

  Fly   353 V 353
            |
 Frog   288 V 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 96/259 (37%)
S_TKc 105..354 CDD:214567 95/258 (37%)
ATS1 445..747 CDD:227511
nek7NP_001072574.1 STKc_Nek6_7 33..294 CDD:270863 96/259 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.