DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and sergef

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001072233.1 Gene:sergef / 779680 XenbaseID:XB-GENE-6455308 Length:349 Species:Xenopus tropicalis


Alignment Length:358 Identity:96/358 - (26%)
Similarity:145/358 - (40%) Gaps:77/358 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 RSVLY--------QLKAFGTCFSMAP---IQLP-PKAVIVDVAMSDSHFVVVNEDGSAYAWGEGT 480
            |.:||        ||....|..:..|   |.|| .:.||..::....|...|.|.|..|..|:.:
 Frog     8 RQLLYAWGANSYGQLGVGSTQDTPVPQLVIGLPNHETVIRSISAGGGHSAAVTESGRVYVCGQNS 72

  Fly   481 HGQLGL---TALEAWKHYPSRMESVRNYHVVSACAGDGFTILVTQAGSLLSCGSNAHLALGQDEQ 542
            .|||||   |.:..:...|..:    ...|.....|..||:::.:.|.|||||:|.:..||:...
 Frog    73 EGQLGLDHTTDVTQFCLCPGAL----GLRVSKVSCGWDFTLILAETGELLSCGANTYSQLGRAGA 133

  Fly   543 RNYHSPKLIARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQKFPQKILLS 607
            .....|:.:. :...:|..|||||:|||||:..|.::.||:      ||.::.::......|...
 Frog   134 GRSCVPRPVG-IQKRKVIDVAAGLRHVLALTDNGQIFQWGS------GLASHARRFSPQNPIPPV 191

  Fly   608 HVKTKPSKI-----YCGPDTSA------VLFANGELHVCGSNDYNKLGFQRSAKITAFKKVQLPH 661
            :..|:|..:     .||...:|      .|...|:::..|||.:.:|       :.....:..||
 Frog   192 YGATEPCPVPGMEGICGKVVTAGSYHCVALSDAGDMYAWGSNKHGQL-------LHPDPFLLHPH 249

  Fly   662 KVTQACF-----------SSTHSVFLVEGGYVYTMGR----------NAEGQ-------RGIRHC 698
            :| ||.|           ..||.|...:.|.|:|.||          :.||.       .|| ..
 Frog   250 RV-QAHFFLGESIVAVTSGWTHLVAQTDTGKVFTWGRANYSQLGRPPSTEGTGLNETLLEGI-PA 312

  Fly   699 NSVDH--PTLVDSVKSR-YIVKANCSDQCTIVA 728
            |.|..  |:|..|.:.. ||..|..|.:|..:|
 Frog   313 NQVPAWIPSLTGSSQMECYIPGAGMSTECAELA 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 90/333 (27%)
sergefNP_001072233.1 RCC1 11..>294 CDD:332518 80/301 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.