DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and rpgr

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_031752069.1 Gene:rpgr / 733454 XenbaseID:XB-GENE-982274 Length:1225 Species:Xenopus tropicalis


Alignment Length:309 Identity:93/309 - (30%)
Similarity:147/309 - (47%) Gaps:30/309 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 VAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVSACAGDGFTILVT 521
            ::..|.|.|:|..:|..|.:|....||||:.|..|... |:.::::::..||.|..|...|::.|
 Frog    42 ISCGDEHTVLVTGNGKLYVFGSNNWGQLGVEAGSAISK-PTCVKALKSEKVVLAACGRHHTLVYT 105

  Fly   522 QAGSLLSCGSNAHLALGQDEQRNYHSPKLIARL-ADVRVEQVAAGLQHVLALSREGAVYVWGTST 585
            :.|.|.|.|.|:...||..:.....|.:.|:.. |..:::|::||.....||:.:|.:::||.::
 Frog   106 EQGKLYSSGGNSEGQLGLGDTAGRTSFQEISFFTAQYKIKQLSAGSNMSAALTVDGKLFMWGDNS 170

  Fly   586 CGALGLGNYQQQQK-----FPQKILLSHVKTKP-SKIYCGPDTSAVLFANGELHVCGSNDYNKLG 644
            .|.|||      :|     .|||:...    || :.|.||...||.:..:|||:..|..:..|||
 Frog   171 EGQLGL------EKGTIYCTPQKVDTG----KPIAWISCGYYHSAFVTQDGELYTFGEPENGKLG 225

  Fly   645 FQRSAKITAFKKVQ----LPHKVTQACFSSTHSVFLVEGGYVYTMGRNAEGQRGIRHCNSV--DH 703
            .... ||...||.|    |..|||.......|::.:.| ..|||.|....||.|  |...:  .|
 Frog   226 LPPD-KIKKHKKPQRVLGLSGKVTMVSCGGEHTIAVTE-KEVYTFGLGQFGQLG--HGTFIFETH 286

  Fly   704 -PTLVDSVKSRYIVKANCSDQCTIVASEDNIITVWGT-RNGLPGIGSTN 750
             |..||::..:.|....|.:..|.:.:|..::..:|. |:|..|:|..|
 Frog   287 IPKAVDALTKKKIRYVTCGENHTAIITEKGLLYTFGDGRHGKLGLGEEN 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 91/304 (30%)
rpgrXP_031752069.1 ATS1 <42..334 CDD:227511 92/306 (30%)
RCC1 315..362 CDD:395335 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.