DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and Nek5

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_008769592.1 Gene:Nek5 / 685440 RGDID:1593817 Length:677 Species:Rattus norvegicus


Alignment Length:252 Identity:100/252 - (39%)
Similarity:163/252 - (64%) Gaps:7/252 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 YEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVSYLG 169
            ::.::::|:|:||...|.:.||:....|.|:|:|::    .::.:.|||.:.:|:.|.|||::..
  Rat     4 FDLIKIIGEGTFGKVYLAKDKSESCHCVIKEISLTK----EKEASKNEVTLLAKMKHSNIVTFFS 64

  Fly   170 SFIKDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKTA 234
            ||.:::.|.|.|||.|||.|.:.|..::|.| |.|..|:..|.|||..:.::|.:.:||||:|:.
  Rat    65 SFQENSRLFIVMEYCDGGDLMERIQRQRGVL-FSEDQILCWFVQISLGLKHIHDKKVLHRDIKSQ 128

  Fly   235 NVFLNRRGIV-KIGDFGISKIMNTKIH-AQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEM 297
            |:||::.|:| |:||||.::.:|..:. |||..|||||.|||:|:.:.|:||:|||:|||:|.|:
  Rat   129 NIFLSKNGMVAKLGDFGTARTLNNSMELAQTCAGTPYYLSPEICQNRPYNNKTDIWSLGCVLYEL 193

  Fly   298 CCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVL 354
            |.||..|.:.||..||.||..|...|:...::..|:||:..|.:|....||:.:.:|
  Rat   194 CTLKHPFESDNLHHLVLKICQGRVAPISPHFSLDLQSLIPQLFRVSPQDRPSINSLL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 100/252 (40%)
S_TKc 105..354 CDD:214567 99/250 (40%)
ATS1 445..747 CDD:227511
Nek5XP_008769592.1 PKc_like 3..255 CDD:304357 100/252 (40%)
S_TKc 4..255 CDD:214567 100/252 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D132059at33208
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.