DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and Nek10

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001381921.1 Gene:Nek10 / 674895 MGIID:2685128 Length:1126 Species:Mus musculus


Alignment Length:292 Identity:88/292 - (30%)
Similarity:147/292 - (50%) Gaps:24/292 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 QMPNRQESLLQLSVPRETGVGVAGPELANYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSE 140
            |:....||:.|...|.:        .:.:|..:..:|.|:||.....|::|..:.:..|::||. 
Mouse   498 QIAENIESINQKKAPLK--------YIGDYAVLDHLGSGAFGCVYKVRKRSGQNLLAMKEVNLH- 553

  Fly   141 LSPP-GRDL---------AMNEVDVF-SKLHHPNIVSYLGSFIKDNTLLIEMEYADGGTLAQIIA 194
             :|. |:|.         .::|:.:. .:|:|||:|.|..:|::::.|.|.||..:|..|.:...
Mouse   554 -NPAFGKDKKDRDSSVKNIVSELTIIKEQLYHPNVVRYYKTFLENDRLYIVMELIEGAPLGEHFN 617

  Fly   195 ERQGK-LHFPERYIIAVFEQISSAINYMHSE-NILHRDLKTANVFLNRRGIVKIGDFGISKIMNT 257
            ..:.| .||.|..:..:|.|:..|:.|:|.| .|:||||...|:.|..:..|.:.|||::|....
Mouse   618 SLKEKHHHFSEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVTVTDFGLAKQKQE 682

  Fly   258 KIHAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCCLKKTFAASNLSELVTKIMAGNYT 322
            .....:::||..|..||:.:.:.|..|:|:||.||||.:|..|...|.::|:..|.|||:...|.
Mouse   683 SSKLTSMVGTILYSCPEVLKSEPYGEKADVWAAGCILYQMATLSPPFCSTNMLSLATKIVEAVYE 747

  Fly   323 PVPSG-YTSGLRSLMSNLLQVEAPRRPTASEV 353
            |||.| |:..:...:...|..:|..||...||
Mouse   748 PVPEGIYSEKVTDTIRRCLTPDAEARPDIVEV 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 83/264 (31%)
S_TKc 105..354 CDD:214567 83/263 (32%)
ATS1 445..747 CDD:227511
Nek10NP_001381921.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..72
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.