DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and RPGR

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001030025.1 Gene:RPGR / 6103 HGNCID:10295 Length:1152 Species:Homo sapiens


Alignment Length:311 Identity:86/311 - (27%)
Similarity:152/311 - (48%) Gaps:26/311 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 VIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVSACAGDGFT 517
            |.|.::..|.|..||..:...|.:|....|||||.:..|... |:.:::::...|..|..|...|
Human    36 VPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISK-PTCVKALKPEKVKLAACGRNHT 99

  Fly   518 ILVTQAGSLLSCGSN--AHLALGQDEQRN-YHSPKLIARLADVRVEQVAAGLQHVLALSREGAVY 579
            ::.|:.|::.:.|.|  ..|.||..|:|| :|......  ::.:::|::||.....||:.:|.::
Human   100 LVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFT--SEHKIKQLSAGSNTSAALTEDGRLF 162

  Fly   580 VWGTSTCGALGLGNYQQQQKFPQKILLSHVKTKP-SKIYCGPDTSAVLFANGELHVCGSNDYNKL 643
            :||.::.|.:||.|. .....||::.:.    || |.|.||...||.:..:|||:|.|..:..||
Human   163 MWGDNSEGQIGLKNV-SNVCVPQQVTIG----KPVSWISCGYYHSAFVTTDGELYVFGEPENGKL 222

  Fly   644 GF-------QRSAKITAFKKVQLPHKVTQACFSSTHSVFLVEGGYVYTMGRNAEGQRGI-RHCNS 700
            |.       .|:.::.:    ::|.||.|......|:|.|.|.. |||.|....||.|: .....
Human   223 GLPNQLLGNHRTPQLVS----EIPEKVIQVACGGEHTVVLTENA-VYTFGLGQFGQLGLGTFLFE 282

  Fly   701 VDHPTLVDSVKSRYIVKANCSDQCTIVASEDNIITVWGT-RNGLPGIGSTN 750
            ...|.::::::.:.|...:|.:..|.:.::..::..:|. |:|..|:|..|
Human   283 TSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLEN 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 84/306 (27%)
RPGRNP_001030025.1 RCC1 <38..312 CDD:332518 79/286 (28%)
RCC1 314..360 CDD:306840 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.