DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and rccd1

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_009296664.1 Gene:rccd1 / 567613 ZFINID:ZDB-GENE-030131-3552 Length:312 Species:Danio rerio


Alignment Length:333 Identity:69/333 - (20%)
Similarity:111/333 - (33%) Gaps:116/333 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 HEILEKRSVLYQLKAFGTCFSMAPIQLPPKAVIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLG- 485
            ||:..:.:....|.:.|......|...|.|...|.:.:...|.:::..||:.|:||.|:||||| 
Zfish    59 HELSAEHTAALPLVSGGFVQHKPPFFHPLKLCAVSLVLGSEHALLLTADGTLYSWGSGSHGQLGH 123

  Fly   486 --LTALEAWKHYPSRMESVRNYHVVSACAGDGFTILVTQAGSLLSCGSNAHLALGQDEQRNYHSP 548
              ||:||                                                        .|
Zfish   124 GALTSLE--------------------------------------------------------DP 132

  Fly   549 KLIARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGL---GNYQQQQKFPQKILLSHVK 610
            :.:..|..|.::.||||..|..|:|..|.:|:||.:..|.|||   |..:::::           
Zfish   133 QAVEALWGVPIKAVAAGNWHSAAVSSGGDLYMWGWNESGQLGLPSRGLEEEKRR----------- 186

  Fly   611 TKPSKIYCGPDTSAVLFANGELHVCGSNDYNKLGFQRSAKITAFKKVQ-LP--------HKVTQA 666
                             .||     ..||...:.....::...|..:| .|        .::::.
Zfish   187 -----------------GNG-----SGNDDQPMNTDEKSQTDVFISIQAFPALVDIANMSEISRI 229

  Fly   667 CFSSTHSVFLVEGGYVYTMGRNAEGQRGIRHCNSVDHPTLVDSVKSRYIVKANCSDQCTIVASED 731
            ...|.|:..:...|.:||.|....||.|....:|.|.||.||...|..:            :.:|
Zfish   230 SCGSRHTAAVTSAGDLYTWGWGQYGQLGHGTEHSTDEPTPVDYFSSHSL------------SVKD 282

  Fly   732 NIITVWGT 739
            .:...|.|
Zfish   283 VVCGSWNT 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 65/310 (21%)
rccd1XP_009296664.1 RCC1_2 92..120 CDD:290274 9/27 (33%)
RCC1 107..156 CDD:278826 23/104 (22%)
RCC1_2 143..172 CDD:290274 11/28 (39%)
RCC1 160..239 CDD:278826 18/111 (16%)
RCC1_2 226..255 CDD:290274 6/28 (21%)
RCC1 243..292 CDD:278826 17/60 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.