DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and nek1

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_009292952.1 Gene:nek1 / 556002 ZFINID:ZDB-GENE-040730-1 Length:1413 Species:Danio rerio


Alignment Length:373 Identity:136/373 - (36%)
Similarity:203/373 - (54%) Gaps:52/373 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 YEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVSYLG 169
            ||:::.:|:||||.|||.:.::||.|.|.|:|.:|.:|...|..:..||.|.:.:.|||||.|..
Zfish     4 YERLKKIGEGSFGKAILVKSRTDGRQYVIKEIGISRMSNKERQESRKEVAVLANMSHPNIVQYKE 68

  Fly   170 SFIKDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKTA 234
            ||.:...|.|.|:|.:||.|.:.|..::|.| |||..|:..|.||..|:.::|...|||||:|:.
Zfish    69 SFEESGCLYIVMDYCEGGDLFKKINNQRGSL-FPEEQILDWFVQICLALKHVHDRKILHRDIKSQ 132

  Fly   235 NVFLNRRGIVKIGDFGISKIMNTKIH-AQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMC 298
            |:||.:.|.|::|||||::::|:.:. |:|.:|||||.|||:||.|.|:||||||||||:|.|||
Zfish   133 NIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMC 197

  Fly   299 CLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVLVYWIPLIFR 363
            .||..|.|.|:..||.||:.|:|.||...|:..||||::.|.:.....||:.|.:|..  |.:.|
Zfish   198 TLKHAFEAGNMKNLVLKIIRGSYPPVSIHYSPDLRSLLAQLFKRNPRERPSVSTILDK--PFLAR 260

  Fly   364 SLGK-------NKGYSY----------------EDDVGGP----GSDQLTAP------------- 388
            .:.|       .:.:|:                :....||    .:.::|.|             
Zfish   261 RIHKFLSPQLIAQEFSHSIHLQPKMSVAHAAPAKRPAPGPIPITSAQKITKPAAKYGVPLTVRRP 325

  Fly   389 ------VPAAAYSNVSMELELPTAQTETKQLMIADTAAPHE--ILEKR 428
                  ||.||...|.::...|.|..:.:...:.:....||  :.:||
Zfish   326 SEVARKVPDAAKKPVKLKQAPPPAAVQRRVSRVEEERRKHEEGVRKKR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 117/254 (46%)
S_TKc 105..354 CDD:214567 116/249 (47%)
ATS1 445..747 CDD:227511
nek1XP_009292952.1 STKc_Nek1 3..258 CDD:270858 118/256 (46%)
S_TKc 4..258 CDD:214567 118/256 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 237 1.000 Domainoid score I2252
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D132059at33208
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.