DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and HERC6

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_005263140.1 Gene:HERC6 / 55008 HGNCID:26072 Length:1034 Species:Homo sapiens


Alignment Length:378 Identity:93/378 - (24%)
Similarity:159/378 - (42%) Gaps:66/378 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 GGPGSDQLTAPVPAAAYSNVSMELELPTAQTETKQLMIADTAAPHEIL----EKRSVLYQLKA-- 436
            |.||::.|.|                  |..|...|::...   |.:|    ..|..|.:..|  
Human    19 GSPGAELLQA------------------ASGERHSLLLLTN---HRVLSCGDNSRGQLGRRGAQR 62

  Fly   437 ------FGTCFSMAPIQLPPKA---VIVD-VAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEA 491
                  .|.||.:.|.: |.:|   :||| |:....|.:.|...|..:|||.|:.||||:...:.
Human    63 GELPVVVGGCFVLFPKE-PIQALETLIVDLVSCGKEHSLAVCHKGRVFAWGAGSEGQLGIGEFKE 126

  Fly   492 WKHYPSRMESVRNYHVVSACAGDGFTILVTQAGSLLSCGSNAH--LALGQDEQRNYHSPKLIARL 554
            ....|.::.::.:..::....|...::.:::...:.|.|.|:|  |.||: |..:..||:.:..|
Human   127 ISFTPKKIMTLNDIKIIQVSCGHYHSLALSKDSQVFSWGKNSHGQLGLGK-EFPSQASPQRVRSL 190

  Fly   555 ADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGLG--NYQQQQKFPQKI-LLSHVKTKPSKI 616
            ..:.:.|||||..|..|||..|..:.||:::.|.|.|.  |...|...|..: .|.::    ..:
Human   191 EGIPLAQVAAGGAHSFALSLCGTSFGWGSNSAGQLALSGRNVPVQSNKPLSVGALKNL----GVV 251

  Fly   617 Y--CGPDTSAVLFANGELHVCGSNDYNKLGFQRSAKITAFKKVQ-LPHKVTQACFSSTHSVFLVE 678
            |  ||...:|||..:|::...|.|...:||:..:.:....:.|: :...|:|....|.|::    
Human   252 YISCGDAHTAVLTQDGKVFTFGDNRSGQLGYSPTPEKRGPQLVERIDGLVSQIDCGSYHTL---- 312

  Fly   679 GGYVYTMGRNAEGQRGIRHCNSVDHPTLVDSVKSRYIVKANCSDQCTIVASED 731
             .||:|.|:......|....:...||..:..         |....| ::::||
Human   313 -AYVHTTGQVVSFGHGPSDTSKPTHPEALTE---------NFDISC-LISAED 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 77/299 (26%)
HERC6XP_005263140.1 RCC1_2 27..54 CDD:290274 7/47 (15%)
RCC1_2 89..118 CDD:290274 10/28 (36%)
RCC1 105..155 CDD:278826 11/49 (22%)
RCC1 158..208 CDD:278826 17/50 (34%)
RCC1 215..263 CDD:278826 13/51 (25%)
RCC1_2 250..279 CDD:290274 9/28 (32%)
RCC1 266..313 CDD:278826 10/51 (20%)
HECTc 684..1026 CDD:238033
HECTc 711..1026 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.