DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and rcc1l

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001007510.1 Gene:rcc1l / 493236 XenbaseID:XB-GENE-963910 Length:449 Species:Xenopus tropicalis


Alignment Length:337 Identity:83/337 - (24%)
Similarity:140/337 - (41%) Gaps:51/337 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 KNKGYSYEDDVGGPGSDQLTAPVPAAAYSNVSMELELPTAQTETKQLMIADTAAPHEILEKRSVL 431
            :.|||.|           :..|.|      :.:.|:.|   .|||.|.::...|...||..:..:
 Frog   136 RTKGYEY-----------ILEPSP------IPLPLDKP---QETKVLQVSCGRAHSLILTDKEGV 180

  Fly   432 YQL--KAFGTC---------FSMAPI-----QLPPKAVIVDVAMSDSHFVVVNEDGSAYAWGEGT 480
            :.|  .::|.|         :|.:.:     :|..:  :|.||....|.:...|.|..|:.|.|.
 Frog   181 FSLGNNSYGQCAREVIEGEIYSESQLIHRVRELDSR--VVQVACGQDHSLFRTEKGEVYSCGWGA 243

  Fly   481 HGQLGLTALEAWKHYPSRM-ESVRNYHVVSACAGDGFTILVTQAGSLLSCGSNAHLALG-QDEQR 543
            .||.||.......: |::: ..:...::|.........:.|::.|.|...|::.:|.|. ..:..
 Frog   244 DGQTGLGHFNVCSN-PTKLGGDMAGVNIVQVATYGDCCLAVSEEGQLYGWGNSEYLQLACVTDST 307

  Fly   544 NYHSPKLIARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGLG-NY---QQQQKFPQKI 604
            ..:.|:.:......:|:.||.|....:|::.:|:|:|||   .|.||.| |:   ||.:..||.:
 Frog   308 QVNVPQHLPFQHVGKVKHVACGGTGCIAVNGDGSVFVWG---YGILGKGPNFLEAQQPEIIPQSL 369

  Fly   605 L-LS--HVKTKPSKIYCGPDTSAVLFANGELHVCGSNDYNKLGFQRSAKITAFKKVQLPHKVTQA 666
            . ||  :...:.:|::.|....|.|...|||.|.|.|....||..|........:|.:|.:|...
 Frog   370 FGLSDFNPDIRVTKVFSGLGHFAALNNRGELFVWGKNLRGCLGTGRFEDQYFPWRVTVPGEVVDV 434

  Fly   667 CFSSTHSVFLVE 678
            .....|.|.||:
 Frog   435 SCGVDHMVALVK 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 64/248 (26%)
rcc1lNP_001007510.1 RCC1 <51..374 CDD:332518 62/263 (24%)
RCC1_2 381..410 CDD:316098 10/28 (36%)
RCC1 398..444 CDD:306840 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.