DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and nek6

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001006700.1 Gene:nek6 / 448328 XenbaseID:XB-GENE-956751 Length:310 Species:Xenopus tropicalis


Alignment Length:256 Identity:98/256 - (38%)
Similarity:153/256 - (59%) Gaps:12/256 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LANYEKVRVVGQGSFGIAILYRRKS--DGHQIVFKQINLSE-LSPPGRDLAMNEVDVFSKLHHPN 163
            ||:::..:.:|:|.|  :.:||...  |...:..|::.:.| :....|...:.|:|:..:|:|||
 Frog    39 LADFKIEKKIGRGQF--SEVYRATCHLDRKPVALKKVQIFEMMDAKARQDCIKEIDLLKQLNHPN 101

  Fly   164 IVSYLGSFIKDNTLLIEMEYADGGTLAQIIA--ERQGKLHFPERYIIAVFEQISSAINYMHSENI 226
            ::.||.|||:||.|.|.:|.||.|.|:|:|.  ::|.:| .|||.:...|.|:.||:.:|||..|
 Frog   102 VIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRL-IPERTVWKYFVQLCSAVEHMHSRRI 165

  Fly   227 LHRDLKTANVFLNRRGIVKIGDFGISKIMNTK-IHAQTVLGTPYYFSPEMCEGKEYDNKSDIWAL 290
            :|||:|.||||:...|:||:||.|:.:..::| ..|.:::|||||.|||......|:.|||||:|
 Frog   166 MHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSL 230

  Fly   291 GCILGEMCCLKKTFAASNLS--ELVTKIMAGNYTPVP-SGYTSGLRSLMSNLLQVEAPRRP 348
            ||:|.||..|:..|....:|  .|..||...:|.|:| ..|:..||.|:|..:..:..:||
 Frog   231 GCLLYEMAALQSPFYGDKMSLFSLCQKIEQCDYPPLPKEHYSEKLRELVSMCIYPDPDQRP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 96/254 (38%)
S_TKc 105..354 CDD:214567 96/253 (38%)
ATS1 445..747 CDD:227511
nek6NP_001006700.1 STKc_Nek6 39..306 CDD:270865 98/256 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R445
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.