DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and rcc2

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_998341.1 Gene:rcc2 / 406455 ZFINID:ZDB-GENE-040426-2213 Length:495 Species:Danio rerio


Alignment Length:492 Identity:117/492 - (23%)
Similarity:169/492 - (34%) Gaps:113/492 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 RSLGKNKGYSYEDDVGGPGSDQLTAPVPAAAYSNVSMELELPTAQTETKQLMIADTAAPHEILEK 427
            |..||.|...:..|......:|.....|..           |.|:...:.:.:||.......||.
Zfish    19 RGGGKKKEREFSSDDEFDDYEQENTKKPGK-----------PAAKAGLQPVTVADDVKEKIKLEV 72

  Fly   428 RSVLYQLKAFG-TCFSMAPIQLPPKAVIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEA 491
            ..|..||..|| |.:.:...:..||        ..:.|..:.::    .||...:|.|       
Zfish    73 PKVKGQLLIFGATNWDLIGRKEVPK--------QQAAFRNLGQN----LWGPHRYGCL------- 118

  Fly   492 WKHYPSRMESVRNYHVVSA-CAGDGFTILVTQAGSLLSCGSNAHLALGQDEQRNYHSPKLIARLA 555
                    ..|:...|||. ||  ..::::|..|.|.|.|.|....||..:.:...:||||..|.
Zfish   119 --------SDVQVSCVVSGPCA--AHSLIITTEGKLWSWGRNDKGQLGHGDTKRLEAPKLIEGLG 173

  Fly   556 DVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKTKP-SKIYCG 619
            :..:...|.|..|.|||:..|.||.:|.:..|.||.||.......|..|   ....:| .|:.||
Zfish   174 EEVIVAAACGRNHTLALTENGTVYTFGENKLGQLGQGNQTDAVLSPATI---QYNGQPIVKVACG 235

  Fly   620 PDTSAVLFANGELHVCGSNDYNKLGFQRSAKITA------FKKVQLPHKVT-------------- 664
            .:.|.::...|.|:..|..:|.:||.....|..|      |....:|.:|.              
Zfish   236 AEFSMIVDCKGNLYSFGCPEYGQLGHNSDGKFIARAQRIEFDCELIPRRVAIFIEKTKDGQVLPV 300

  Fly   665 -------QACFSSTHSVFLVEGGYVYTMGRNAEGQRGIRHCNSVDH--PTLVD--SVKSRYIVKA 718
                   .|| .:.|::.|.....|::.|....|:.|  |....|.  |.||.  ....|...:.
Zfish   301 PNVVARDVAC-GANHTLVLDSQKRVFSWGFGGYGRLG--HAEQKDEMVPRLVKLFDFPGRGATQI 362

  Fly   719 NCSDQCTIVASEDNIITVWGTRN-------------GLPG--IGSTNCGLGLQIC---------- 758
            .|..||:...||...:..||..|             .|.|  |.|..||....|.          
Zfish   363 YCGYQCSFALSEMGGLFFWGVTNTSRESTMYPKAVQDLCGWKIRSLACGKSSIIVAADDSTISWG 427

  Fly   759 -TPNM-ELELGNN------TAAFTNFLASVYKSELIL 787
             :|.. ||..|:|      ||.....|..||..::::
Zfish   428 PSPTFGELGYGDNKPKSSTTAQEVKTLDGVYSEQVVM 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 83/349 (24%)
rcc2NP_998341.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 9/47 (19%)
RCC1 1 76..138 18/90 (20%)
RCC1_2 121..154 CDD:290274 12/34 (35%)
RCC1 2 141..192 18/50 (36%)
RCC1 141..190 CDD:278826 16/48 (33%)
RCC1 193..242 CDD:278826 16/51 (31%)
RCC1 3 194..244 16/52 (31%)
RCC1 245..318 CDD:278826 14/73 (19%)
RCC1 4 246..320 15/74 (20%)
Required for interaction with RAC1. /evidence=ECO:0000250|UniProtKB:Q9P258 291..298 0/6 (0%)
RCC1 5 321..374 13/54 (24%)
RCC1 323..372 CDD:278826 13/50 (26%)
RCC1 6 376..420 10/43 (23%)
RCC1 7 421..474 10/44 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.