DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and Rcc1

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster


Alignment Length:388 Identity:82/388 - (21%)
Similarity:160/388 - (41%) Gaps:58/388 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 PAAAYSNVSMELELPTAQTETKQLM------IADTAAPHEILEKRSVLYQLKAFGTCFSMAPIQL 448
            |.|..:.::..||||..:|....::      :.......:|||::             .::|:..
  Fly    21 PKAKRARIAFHLELPKRRTVLGNVLVCGNGDVGQLGLGEDILERK-------------RLSPVAG 72

  Fly   449 PPKAVIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGL-TALEAWKHYPSRMESVRNYHVVSACA 512
            .|.|  ||::....|.:|:.:.|..|::|....|.||. |:.:..:..|..::.......:|  |
  Fly    73 IPDA--VDISAGGMHNLVLTKSGDIYSFGCNDEGALGRDTSEDGSESKPDLIDLPGKALCIS--A 133

  Fly   513 GDGFTILVTQAGSLLSCGS--NAHLALGQDEQRNYHSPKLIARLADVRVEQVAAGLQHVLALSRE 575
            ||..:..:.:.|.:.:.||  ::|..:|.....|..:|  |..:.......:|:|..|::.|:..
  Fly   134 GDSHSACLLEDGRVFAWGSFRDSHGNMGLTIDGNKRTP--IDLMEGTVCCSIASGADHLVILTTA 196

  Fly   576 GAVYVWGTSTCGALG-------LGNYQQQQK---FPQKILLSHVKTKPSKI-----YC---GPDT 622
            |.|:..|.:..|.||       .|..::.::   .|.:::::  :.||.:.     ||   ....
  Fly   197 GKVFTVGCAEQGQLGRLSERSISGEGRRGKRDLLRPTQLIIT--RAKPFEAIWATNYCTFMRESQ 259

  Fly   623 SAVLFANGELHVCGSNDYNKLGFQRSAKITAFKKVQLPHK-VTQACFSSTHSVFLVEGGYVYTMG 686
            :.|::|.      |.|::.:|..:...|..|...::...| :........|:|.|........:|
  Fly   260 TQVIWAT------GLNNFKQLAHETKGKEFALTPIKTELKDIRHIAGGQHHTVILTTDLKCSVVG 318

  Fly   687 RNAEGQRGIRHCNS-VDHPTLVDSVKSRYIVKANCSDQCTIVASEDNIITVWGTR-NGLPGIG 747
            |...|:.|:..... |:.||:|..:..: ||...|.:.|:...:.|..:..||:. |...|:|
  Fly   319 RPEYGRLGLGDVKDVVEKPTIVKKLTEK-IVSVGCGEVCSYAVTIDGKLYSWGSGVNNQLGVG 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 71/325 (22%)
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 9/61 (15%)
RCC1 92..141 CDD:278826 12/50 (24%)
RCC1_2 131..158 CDD:290274 7/28 (25%)
RCC1 144..193 CDD:278826 11/50 (22%)
RCC1_2 182..209 CDD:290274 7/26 (27%)
RCC1 363..414 CDD:278826 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.