DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and Herc4

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster


Alignment Length:311 Identity:92/311 - (29%)
Similarity:141/311 - (45%) Gaps:24/311 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 YAWGEGTHGQLGLTALEAWKHY-PSRMESVRNYHVVSACAGDGFTILVTQAGSLLSCGSNAHLAL 537
            |.||..:||||||..:|..:.. ||::....:..|.....|...|:.:|..|.:.:||||.:..|
  Fly     8 YCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQL 72

  Fly   538 GQD--EQRNYHSP-KLIARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQK 599
            |.|  .:|...|| .||..|.|..:.|:..|.:|.||||..|.|..||.:.||.||....::..:
  Fly    73 GHDLPTKRPRMSPFLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQ 137

  Fly   600 FPQKILLSHVKTKPSKIYCGPDTSAVLFANGELHVCGSNDYNKLGFQRSAKITAFKKVQLPHKVT 664
            .| |::...|.....:|.||.:.|..|.:.|||:..|||.|.:||......:|   ....|.::|
  Fly   138 LP-KVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLT---HCNYPLRLT 198

  Fly   665 Q---------ACFSSTHSVFLVEGGYVYTMGRNAEGQRGIRHCNSVDHPTLVDSVKSRYIVKANC 720
            .         || ...||..:.:.|.|:..|||..||.|:....:..:||.:.::::..:....|
  Fly   199 TLLGIPLAAIAC-GGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVAC 262

  Fly   721 SDQCTI-VASEDNIITVWGTRNGLPGIGSTNCGLGLQICTPNMELELGNNT 770
            .|:.:: :.:|..:.|.     |....|....|.......|.|.:||..:|
  Fly   263 GDEFSVFLTNEGGVFTC-----GAGAYGQLGHGFSSNEMLPRMVMELMGST 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 85/286 (30%)
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 15/46 (33%)
RCC1 59..110 CDD:278826 19/50 (38%)
RCC1 114..163 CDD:278826 15/49 (31%)
RCC1 167..218 CDD:278826 16/54 (30%)
RCC1 221..270 CDD:278826 12/48 (25%)
RCC1 273..322 CDD:278826 10/41 (24%)
RCC1_2 309..339 CDD:290274 92/311 (30%)
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.