DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and Rpgr

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_038955861.1 Gene:Rpgr / 367733 RGDID:1560136 Length:1380 Species:Rattus norvegicus


Alignment Length:386 Identity:98/386 - (25%)
Similarity:168/386 - (43%) Gaps:66/386 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 APVPAAAYSNVSMELELPTAQTETKQLMIADTAAPHEILEKRSVLYQLKAFG-TCFSMAPIQLPP 450
            |.:|.||:.         .|:.|:   ::.||.|             :..|| |.|:.   .:|.
  Rat    30 AQIPFAAFG---------MAEPES---LVPDTGA-------------VFTFGKTKFAE---NIPS 66

  Fly   451 K-----AVIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVSA 510
            |     .|.:.::..|.|..:|..:...|.:|....|||||.:..|... |:.:::::...|..|
  Rat    67 KFWFKNDVPICLSCGDEHTAIVTGNNKLYMFGSNNWGQLGLGSKSAISK-PTCIKALKPEKVKLA 130

  Fly   511 CAGDGFTILVTQAGSLLSCGSN--AHLALGQDEQRN------YHSPKLIARLADVRVEQVAAGLQ 567
            ..|...|::.|..|.:.:.|.|  ..|.||..:.|:      :.:|      :|: ::|::||..
  Rat   131 ACGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIGFFTP------SDI-IKQLSAGAN 188

  Fly   568 HVLALSREGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKT--KP-SKIYCGPDTSAVLFAN 629
            ...||:.:|.:::||.::.|.:||.|       ...:.:.|..|  || |.|.||...||.:..:
  Rat   189 TSAALTEDGKLFMWGDNSEGQIGLKN-------KSNVCIPHEVTVGKPISWISCGYYHSAFVTTD 246

  Fly   630 GELHVCGSNDYNKLGFQRSAKI---TAFKKVQLPHKVTQACFSSTHSVFLVEGGYVYTMGRNAEG 691
            |||:..|..:..|||......|   :..:.:.:|.||.|......|:|.|.| ..||..|....|
  Rat   247 GELYTFGEPENGKLGLPNQLLINHRSPQRVLGIPDKVIQVACGGGHTVVLTE-KVVYAFGLGQFG 310

  Fly   692 QRGI-RHCNSVDHPTLVDSVKSRYIVKANCSDQCTIVASEDNIITVWGT-RNGLPGIGSTN 750
            |.|: ........|.::|.:|.:.|...:|.:..|.:.::..::..:|. |:|..|:|..|
  Rat   311 QLGLGTFLFETSEPKIIDRIKDQKISHISCGENHTALMTDIGLMYTFGDGRHGKLGLGMEN 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 83/322 (26%)
RpgrXP_038955861.1 ATS1 <78..368 CDD:227511 80/305 (26%)
RCC1 352..398 CDD:395335 6/20 (30%)
MDN1 <625..904 CDD:227596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.