DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and Rcbtb1

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001101850.1 Gene:Rcbtb1 / 361050 RGDID:1308467 Length:531 Species:Rattus norvegicus


Alignment Length:376 Identity:95/376 - (25%)
Similarity:156/376 - (41%) Gaps:29/376 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 KAVIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVSACAGDG 515
            ||.:..::.|::  :.|.:....:.:|......|| |........|.::|::....:.|...|.|
  Rat    23 KACVFGISASEA--IYVTDSDEVFVFGLNYSNCLG-TGDNQSTLVPKKLEALCGKRIKSLSYGSG 84

  Fly   516 -FTILVTQAGSLLSCGSNAHLALGQDEQRNYHSP-KLIARLADVRVEQVAAGLQHVLALSREGAV 578
             ..:|.|:.|.:.:.|.|.:..||........:| ::...|...:|.:||.|..|.:||:.:|.:
  Rat    85 PHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGIAPIQVCTNLLVKQVVEVACGSHHSMALAADGEL 149

  Fly   579 YVWGTSTCGALGLGNYQQQQKFPQKIL-LSHVKTKPSKIYCGPDTSAVLFANGELHVCGSNDYNK 642
            :.||.:.||.:|.|: ...|..|:|:. ..|.| |...|.||..:|..:..:||::..|.|...:
  Rat   150 FAWGYNNCGQVGSGS-TANQPTPRKVTNCLHTK-KVVNIACGQTSSMAVLDSGEVYGWGYNGNGQ 212

  Fly   643 LGFQRSAKITAFKKVQLPHK--VTQACFSSTHSVFLVEGGYVYTMGRNAEGQRGIRHCNSVDHPT 705
            ||...:.......:|...|.  |.|......|::.|.:.|.:|..|.|..||.|....|::..||
  Rat   213 LGLGNNGNQLTPVRVAALHGVCVNQIVCGYAHTLALTDEGLLYAWGANTYGQLGTGSKNNLLSPT 277

  Fly   706 LVDSVKSRYIVKANCSDQCTIVA-SEDNIITVWGTRNG----LPGIGSTNCGLGLQICTPNMELE 765
            .:...|.|.|..|.|....|..| ::...:.:||...|    ||.:...:|...:..|.      
  Rat   278 QIMVEKERVIEIAACHSTHTSAAKTQGGHVYMWGQCRGQSVILPHLTHFSCTDDVFACF------ 336

  Fly   766 LGNNTAAFTNFLASVYKSELILEPVDILALFSSKEQCD-----RGYYVQVH 811
               .|.|.:..|.||...:.:.....:...|.|.|..|     .|.|:.||
  Rat   337 ---GTPAVSWRLLSVEHEDFLTVAESLKKEFDSPETADLKFRIDGKYIHVH 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 80/305 (26%)
Rcbtb1NP_001101850.1 RCC1 42..89 CDD:395335 9/47 (19%)
ATS1 <91..363 CDD:227511 73/282 (26%)
BTB_POZ_RCBTB1_CLLD7 350..466 CDD:349662 8/35 (23%)
BACK_RCBTB1 466..531 CDD:350603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.