DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and Nek6

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001264161.1 Gene:Nek6 / 360161 RGDID:727779 Length:313 Species:Rattus norvegicus


Alignment Length:300 Identity:103/300 - (34%)
Similarity:159/300 - (53%) Gaps:27/300 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GAASTSLAEAMSSSKAQMPNRQESLLQLSVPRETGVGVAGPELANYEKVRVVGQGSFG----IAI 120
            |.:...|...:..:....|.|..:.|....           .||:::..:.:|:|.|.    ...
  Rat    11 GGSPNHLCHVLGPAHPPDPQRHPNTLSFRC-----------SLADFQIEKKIGRGQFSEVYKATC 64

  Fly   121 LYRRKSDGHQIVFKQINLSE-LSPPGRDLAMNEVDVFSKLHHPNIVSYLGSFIKDNTLLIEMEYA 184
            |..||:    :..|::.:.| :....|...:.|:.:..:|:||||:.||.|||:||.|.|.:|.|
  Rat    65 LLDRKT----VALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELA 125

  Fly   185 DGGTLAQIIA--ERQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKTANVFLNRRGIVKIG 247
            |.|.|:|:|.  ::|.:| .|||.:...|.|:.||:.:|||..::|||:|.||||:...||||:|
  Rat   126 DAGDLSQMIKYFKKQKRL-IPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLG 189

  Fly   248 DFGISKIMNTK-IHAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCCLKKTFAAS--NL 309
            |.|:.:..::: ..|.:::|||||.|||......|:.|||||:|||:|.||..|:..|...  ||
  Rat   190 DLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNL 254

  Fly   310 SELVTKIMAGNYTPVP-SGYTSGLRSLMSNLLQVEAPRRP 348
            ..|..||...:|.|:| ..|:..||.|:|..:..:...||
  Rat   255 FSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPNHRP 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 95/255 (37%)
S_TKc 105..354 CDD:214567 95/254 (37%)
ATS1 445..747 CDD:227511
Nek6NP_001264161.1 Interaction with ARHGAP33, ANKRA2, CDC42, PRDX3, RAD26L, RBBP6, RPS7 and TRIP4. /evidence=ECO:0000250 1..44 6/43 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 3/19 (16%)
STKc_Nek6_7 44..305 CDD:270863 95/255 (37%)
Interaction with APBB1. /evidence=ECO:0000250 267..270 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.