DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and CG7420

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001259871.1 Gene:CG7420 / 33332 FlyBaseID:FBgn0031344 Length:388 Species:Drosophila melanogaster


Alignment Length:289 Identity:65/289 - (22%)
Similarity:117/289 - (40%) Gaps:63/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 VPAAAYSNVSMEL-----ELPTAQTETKQLMIADTAAPHEILEKRSVLYQLKAFGTC---FSMA- 444
            :|...:.:|.:|.     ::..|.|.||:|.:..:.|             .:..|.|   |:.. 
  Fly    84 IPTEYFGDVPVETISCGWDISGAITLTKRLFVWGSNA-------------FQQLGICQRGFTAVR 135

  Fly   445 ---PIQLPPKAVIVDVAMSDSHFVVVNEDGSAYAWG-----EGTHGQLGLTA--------LEAWK 493
               |::||.:.....::....|..|:.:|...|.:|     :....:|.:||        ::...
  Fly   136 RPMPVKLPREEPAQRISFGLRHCAVLTQDNKIYVFGRLRIMDPPPIELDITATCLHRCNTVKIQV 200

  Fly   494 HYPSRMESVR----NYHVVSACAGDGFTILVTQAGS---LLSCGSNAHLALGQDEQRNYHSPKLI 551
            |.|:.:..|.    ..|:|..||    .:..|..||   :|:.|.|   ..||.....:..    
  Fly   201 HNPNELRIVSISSGQNHMVLKCA----DLSETGGGSTKRILTLGDN---KFGQSNAFQFEE---- 254

  Fly   552 ARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKTK-PSK 615
                |||  |:|.|..|..|:.:...:.|||.:..|.||:|::.:||..|..:.|...:.: |::
  Fly   255 ----DVR--QLAVGWTHNAAVLKNNEILVWGRNCYGQLGMGSFSEQQAIPTPLRLKLPEDQGPAR 313

  Fly   616 IYCGPDTSAVLFANGELHVCGSNDYNKLG 644
            |:.|.:...:....||::..|.|::...|
  Fly   314 IHMGAEHGLLRTTAGEVYTWGWNEHGNCG 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 53/221 (24%)
CG7420NP_001259871.1 RCC1 2..52 CDD:278826
RCC1 55..107 CDD:278826 3/22 (14%)
RCC1 112..161 CDD:278826 9/61 (15%)
RCC1_2 256..285 CDD:290274 10/30 (33%)
RCC1 274..320 CDD:278826 14/45 (31%)
RCC1 328..>348 CDD:278826 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.