DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and CG3862

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_608550.1 Gene:CG3862 / 33261 FlyBaseID:FBgn0031286 Length:454 Species:Drosophila melanogaster


Alignment Length:343 Identity:82/343 - (23%)
Similarity:130/343 - (37%) Gaps:97/343 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 KRSVLYQLKAFGTCFSMAPIQLPPKAVIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGL----- 486
            ||.||.|.|:....:|       ||.       :|||      :...|.||....|.|||     
  Fly    20 KRGVLAQDKSKIKEYS-------PKT-------TDSH------EHRVYVWGFQETGALGLQTNVK 64

  Fly   487 TALEAWK---HYPSRMESVRNYHVVSACAGDGFTILVT---QAGSLLSCGSNAHLALGQDEQRNY 545
            .|.|.:.   |:|:|::...|..:....||.|||:...   ...:|...|.|....||...:.|.
  Fly    65 KAKERYTEMVHHPTRLQFSNNNEITDVAAGYGFTVYAVNRDDGETLFGSGLNTDSQLGFQVKGNP 129

  Fly   546 HSPKLIARL-------------------ADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGL 591
            :.|   |.|                   .|:||:.::||..|::.|::.|.::..|.::.|..|.
  Fly   130 NDP---ANLDVIIYPTAIKLPRVQGETDEDMRVKSMSAGRAHLVVLTQNGTIFTLGNNSYGQCGR 191

  Fly   592 GNYQQQQKFPQKILLSHVKTKPSKIYCGPDTSAVLFANGELHVCGSNDYNKLGFQRSAKITAFKK 656
            ...:::              :.||       ||::....:..:||..|                 
  Fly   192 SIIEEE--------------RYSK-------SALIHRISQEDICGKED----------------- 218

  Fly   657 VQLPHKVTQACFSSTHSVFLVEGGYVYTMGRNAEGQRGIRHCNSVDHPTLV-DSVKSRYIVKANC 720
                 :|.|......||:||.:.|.:||.|..|:||.|..:.::....||: ..|:...||:.:|
  Fly   219 -----EVVQVECGQDHSMFLTKKGRIYTCGWGADGQTGQGNYHTAGQITLIGGDVEKEKIVRLSC 278

  Fly   721 SDQCTIVASEDNIITVWG 738
            |..|.:..:|......||
  Fly   279 SSDCVLALNEAGDAFGWG 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 75/325 (23%)
CG3862NP_608550.1 RCC1 43..99 CDD:278826 17/55 (31%)
RCC1_2 159..188 CDD:290274 7/28 (25%)
RCC1 175..233 CDD:278826 15/100 (15%)
RCC1_2 220..249 CDD:290274 11/28 (39%)
RCC1 236..286 CDD:278826 16/49 (33%)
RCC1 290..341 CDD:278826 2/7 (29%)
RCC1 345..395 CDD:278826
RCC1_2 386..414 CDD:290274
RCC1 402..449 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.