DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and Nek5

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_006509217.1 Gene:Nek5 / 330721 MGIID:2142824 Length:661 Species:Mus musculus


Alignment Length:330 Identity:117/330 - (35%)
Similarity:194/330 - (58%) Gaps:17/330 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 NYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVSYL 168
            |:..::::|:|:||...|.:.||:....|.|:|:|::    .::.:.|||.:.:::.|||||::.
Mouse     3 NFHLIKIIGEGTFGKVYLAKDKSESSHCVIKEISLTK----EKEASKNEVILLARMEHPNIVTFF 63

  Fly   169 GSFIKDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKT 233
            .||.::..|.|.|||.|||.|.|.| :||..:.|.|..|:..|.|||..:.::|...|||||:|:
Mouse    64 SSFQENGRLFIVMEYCDGGDLMQRI-QRQRGVMFSEDQILCWFVQISLGLKHIHDRKILHRDIKS 127

  Fly   234 ANVFLNRRGIV-KIGDFGISKIMNTKIH-AQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGE 296
            .|:||::.|:| |:||||.::.:|..:. |||..|||||.|||:|:.:.|:||:|||:|||:|.|
Mouse   128 QNIFLSKNGMVAKLGDFGTARTLNDSMELAQTCAGTPYYLSPEICQNRPYNNKTDIWSLGCVLYE 192

  Fly   297 MCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVL--VYWIP 359
            :|.||..|.::|...||.||..|...|:...::..|:||:..|.:|....||:.:.:|  .:...
Mouse   193 LCTLKHPFESNNFHHLVLKICQGRVAPISPHFSRDLQSLIPQLFRVSPQDRPSVTSLLKRPFLET 257

  Fly   360 LIFRSL------GKNKGYSYEDDVG-GPGSDQLTAPVPAAAYSNVSMELELPTAQTETKQLMIAD 417
            ||.|||      .:.:.:::.:::. ||.:....:|. :|||.....|.:....:.|.:..:...
Mouse   258 LIARSLYPEVCSRRIQSHAHMENMAIGPTACWRVSPW-SAAYLQRKFEAQQYKLKVERQLGLRPS 321

  Fly   418 TAAPH 422
            :..||
Mouse   322 SVEPH 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 102/258 (40%)
S_TKc 105..354 CDD:214567 100/250 (40%)
ATS1 445..747 CDD:227511
Nek5XP_006509217.1 STKc_Nek5 3..255 CDD:173765 102/256 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D132059at33208
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R445
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.