Sequence 1: | NP_651293.1 | Gene: | niki / 42959 | FlyBaseID: | FBgn0045980 | Length: | 841 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017451567.1 | Gene: | Herc1 / 315771 | RGDID: | 1306366 | Length: | 4876 | Species: | Rattus norvegicus |
Alignment Length: | 262 | Identity: | 78/262 - (29%) |
---|---|---|---|
Similarity: | 127/262 - (48%) | Gaps: | 12/262 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 460 SDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVSACAGDGFTILVTQAG 524
Fly 525 SLLSCGSNAHLALGQDEQRNYHSPKLIARLADVRVEQVAAGLQHVLALSREGA-VYVWGTSTCGA 588
Fly 589 LGLGNYQQQQKFPQKI-LLSHVKTKPSKIYCGPDTSAVLFANGELHVCGSNDYNKLGFQRSAKIT 652
Fly 653 AFKKVQLP----HKVTQACFSSTHSVFLVEGGYVYTMGRNAEGQRGIRHCNSVDHPTLVDSVKSR 713
Fly 714 YI 715 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
niki | NP_651293.1 | STKc_Nek | 104..359 | CDD:270855 | |
S_TKc | 105..354 | CDD:214567 | |||
ATS1 | 445..747 | CDD:227511 | 78/262 (30%) | ||
Herc1 | XP_017451567.1 | RCC1 | 421..472 | CDD:278826 | |
RCC1 | 476..526 | CDD:278826 | |||
RCC1 | 529..576 | CDD:278826 | |||
RCC1 | 579..629 | CDD:278826 | |||
RCC1 | 633..680 | CDD:278826 | |||
RCC1_2 | 667..696 | CDD:290274 | |||
RCC1 | 683..733 | CDD:278826 | |||
SPRY_HERC1 | 2030..2187 | CDD:293939 | |||
UBA_HERC1 | 2751..2794 | CDD:270584 | |||
WD40 | 3409..3793 | CDD:225201 | |||
WD40 | 3439..3790 | CDD:295369 | |||
WD40 repeat | 3447..3490 | CDD:293791 | |||
WD40 repeat | 3504..3539 | CDD:293791 | |||
WD40 repeat | 3544..3591 | CDD:293791 | |||
WD40 repeat | 3600..3638 | CDD:293791 | |||
WD40 repeat | 3644..3679 | CDD:293791 | |||
WD40 repeat | 3687..3718 | CDD:293791 | |||
WD40 repeat | 3765..3801 | CDD:293791 | |||
RCC1 | 4060..4112 | CDD:278826 | 3/6 (50%) | ||
RCC1 | 4115..4164 | CDD:278826 | 12/49 (24%) | ||
RCC1 | 4167..4216 | CDD:278826 | 15/48 (31%) | ||
RCC1 | 4219..4269 | CDD:278826 | 18/52 (35%) | ||
RCC1 | 4272..4321 | CDD:278826 | 6/50 (12%) | ||
RCC1_2 | 4308..4337 | CDD:290274 | 8/28 (29%) | ||
RCC1 | 4325..4373 | CDD:278826 | 17/36 (47%) | ||
HECTc | 4488..4856 | CDD:238033 | |||
HECTc | 4519..4852 | CDD:214523 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1062377at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |