DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and Hectd3

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_008762291.1 Gene:Hectd3 / 313525 RGDID:1309823 Length:861 Species:Rattus norvegicus


Alignment Length:373 Identity:71/373 - (19%)
Similarity:120/373 - (32%) Gaps:131/373 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 PVPS-GYTSGLRSLMSNLLQVEAPRRPTASEVLVYWIPLIFRSLGKNKGYSYEDDVGGPGSDQLT 386
            |.|: .||..::    .||.|.........|.|:::   ::..|||      ||:..| ...|..
  Rat   194 PQPAEAYTEAVQ----RLLYVPPTWTYECDEDLIHF---LYDHLGK------EDENLG-SVKQYV 244

  Fly   387 APVPAAAY-----------SNVSMELELPTAQ------------TETKQLMIADTAAPHEILEKR 428
            ..:..::|           ||.....|...:|            |..|:|::.........:.||
  Rat   245 ESIDVSSYTEEFNVSCLTDSNADTYWESDGSQCQHWVRLTMKKGTIVKKLLLTVDTTDDNFMPKR 309

  Fly   429 SVLY-----QLKAFGTCFSMAPIQLPPKAVIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTA 488
            .|:|     .||      .::.:.: .:.:|.||.:.:...|                       
  Rat   310 VVVYGGEGDNLK------KLSDVNI-DETLIGDVCVLEDMTV----------------------- 344

  Fly   489 LEAWKHYPSRMESVRNYHVVSACAGDGFTI----LVTQAGSLLSCGSNAHL-----------ALG 538
                 |.|     |....:|. |..||..:    :..::......|.||.|           ..|
  Rat   345 -----HLP-----VIEIRIVE-CRDDGIDVRLRGVKIKSSRQRELGLNADLFQPASLVRYPRLEG 398

  Fly   539 QDEQRNYHSPKLIARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQKFPQK 603
            .|.:..|....|:.|...: ::.|   |.|:        |..|..:      ||.:.:.::..|.
  Rat   399 TDPEVLYRRAVLLQRFIKI-LDSV---LHHL--------VPAWDHT------LGTFSEIKQVKQF 445

  Fly   604 ILLSHVKTKPSKI-YCGPDTSAV-------LFANGEL----HVCGSND 639
            :|||  :.:||.: .|..|:.:.       |:.|..|    ..|.|.|
  Rat   446 LLLS--RQRPSLVTQCLRDSESSKPSFMPRLYINRRLAMEHRACPSRD 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 9/36 (25%)
S_TKc 105..354 CDD:214567 8/31 (26%)
ATS1 445..747 CDD:227511 41/222 (18%)
Hectd3XP_008762291.1 APC10-HECTD3 238..371 CDD:176487 27/174 (16%)
HECT 579..845 CDD:395507
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.