DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and png

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_477492.1 Gene:png / 31084 FlyBaseID:FBgn0000826 Length:291 Species:Drosophila melanogaster


Alignment Length:207 Identity:72/207 - (34%)
Similarity:108/207 - (52%) Gaps:11/207 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VRVVGQGSFGIAILYR----RKSDGHQIVFKQINLSELSPPGRDLAM--NEVDVFSKLHHPNIVS 166
            |||:|||:||...|..    |.....::..|:|.:..   |..:|.:  .||.:.|:|.||:||.
  Fly    11 VRVLGQGTFGRVFLCHQNEVRGQPERKVCVKRIIVRN---PKTELGLIKEEVYIISQLRHPHIVE 72

  Fly   167 YLGSFIKDNTLLIEMEYADGGTLAQIIAE-RQGKLHFPERYIIAVFEQISSAINYMHSENILHRD 230
            :|.||....|:.|.|||...|||..:|.: ..|.....:..::..|..:...:.|:|...::|||
  Fly    73 FLRSFSHAGTVNIVMEYVPNGTLRDVIQQLPSGTGGVNQERLMGYFRDMVVGLEYLHIRCVIHRD 137

  Fly   231 LKTANVFLNRRGIVKIGDFGISKIMNTKIHAQTVLGTPYYFSPE-MCEGKEYDNKSDIWALGCIL 294
            :|..|:.|:....|||.||||:.:.......|..:|||.|.:|| |....:.|.|||:|:||.:|
  Fly   138 IKPENMLLDANDRVKIADFGIANVHAPSTQLQAGMGTPMYMAPEAMSSQGKVDFKSDVWSLGLVL 202

  Fly   295 GEMCCLKKTFAA 306
            .|:|..:..|||
  Fly   203 YELCLGRSPFAA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 72/207 (35%)
S_TKc 105..354 CDD:214567 72/207 (35%)
ATS1 445..747 CDD:227511
pngNP_477492.1 PKc_like 9..>214 CDD:304357 70/205 (34%)
S_TKc 11..271 CDD:214567 72/207 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.