DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and Herc4

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001012074.1 Gene:Herc4 / 309758 RGDID:1310971 Length:1057 Species:Rattus norvegicus


Alignment Length:287 Identity:88/287 - (30%)
Similarity:133/287 - (46%) Gaps:21/287 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 IVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVSACAGDGFTI 518
            ||.|:..::|.:.:|:.|..||||..:.|||||...|.....|..::|:.:..:|....|...::
  Rat    86 IVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQVACGYYHSL 150

  Fly   519 LVTQAGSLLSCGSNAH--LALGQDEQRNYHSPKLIARLADVRVEQVAAGLQHVLALSREGAVYVW 581
            .:::|..:...|.|.:  |.||.:.|:. .||:||..|..:...|||||..|...|:..||::.|
  Rat   151 ALSKASEVFCWGQNKYGQLGLGIECQKQ-TSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGW 214

  Fly   582 GTSTCGALGLGNYQQQQKFPQKILLSHVKTKPSKIYCGPDTSAVLFANGELHVCGSNDYNKLGF- 645
            |.:..|.|||.:  :..::...:|.|....|...|.||.|.:|.|...|.:...|:..|.:||. 
  Rat   215 GRNKFGQLGLND--ENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHN 277

  Fly   646 QRSAKITAFKKVQLPHK-VTQ-ACFSSTHSVFLVEGGYVYTMGRNAEGQRGIRHCNSVDHPTLVD 708
            ..|.:|...|..:|... ||| ||.....|.|:...|.:|:.|....||.|...         ..
  Rat   278 STSHEINPRKVFELMGSIVTQIACGRQHTSAFVPSSGRIYSFGLGGNGQLGTGS---------TS 333

  Fly   709 SVKSRYIVKAN---CSDQC-TIVASED 731
            :.||.:.||.|   .:.|| ..:.|||
  Rat   334 NRKSPFTVKGNWFSYNGQCPQDIGSED 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 88/287 (31%)
Herc4NP_001012074.1 RCC1 1 1..51
RCC1 3..49 CDD:278826
RCC1 2 52..101 4/14 (29%)
RCC1 52..99 CDD:278826 4/12 (33%)
RCC1 3 102..154 15/51 (29%)
RCC1 102..152 CDD:278826 15/49 (31%)
RCC1 4 156..207 18/51 (35%)
RCC1 157..205 CDD:278826 17/48 (35%)
RCC1 5 208..259 17/52 (33%)
RCC1 208..257 CDD:278826 16/50 (32%)
RCC1 260..308 CDD:278826 14/47 (30%)
RCC1 6 261..311 16/49 (33%)
RCC1 7 313..366 16/57 (28%)
RCC1 313..>343 CDD:278826 9/38 (24%)
HECTc 709..1055 CDD:238033
HECTc 735..1054 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.