DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and HERC4

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_011537894.1 Gene:HERC4 / 26091 HGNCID:24521 Length:1081 Species:Homo sapiens


Alignment Length:416 Identity:106/416 - (25%)
Similarity:158/416 - (37%) Gaps:93/416 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 IVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPS--------------------- 497
            ||.|:..::|.:.:|:.|..||||..:.|||||...|.....||                     
Human    86 IVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLVGSEECIRVPSCFPKIMCVDSLVRICSGLSYG 150

  Fly   498 ---RMESVRNYHVVSACAGDGFTILVTQAGSLLSCGSNAH--LALGQDEQRNYHSPKLIARLADV 557
               .::|:.:..:|....|...::.:::|..:...|.|.:  |.||.|.::. .||:|:..|..:
Human   151 RIRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGTDCKKQ-TSPQLLKSLLGI 214

  Fly   558 RVEQVAAGLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKTKPSKIYCGPDT 622
            ...|||||..|...|:..||::.||.:..|.|||.:  :..::...:|.|....|...|.||.|.
Human   215 PFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLND--ENDRYVPNLLKSLRSQKIVYICCGEDH 277

  Fly   623 SAVLFANGELHVCGSNDYNKLGF-QRSAKITAFKKVQLPHKVTQ--ACFSSTHSVFLVEGGYVYT 684
            :|.|...|.:...|:..|.:||. ..|.:|...|..:|...:..  ||.....|.|:...|.:|:
Human   278 TAALTKEGGVFTFGAGGYGQLGHNSTSHEINPRKVFELMGSIVTEIACGRQHTSAFVPSSGRIYS 342

  Fly   685 MGRNAEGQRGIRHCNSVDHPTLVDSVKSRYIVKANCSDQCTIVASEDNIITVWGTRNG--LPGIG 747
            .|....||.|...         ..:.||.:.||.|                 |...||  ||.|.
Human   343 FGLGGNGQLGTGS---------TSNRKSPFTVKGN-----------------WYPYNGQCLPDID 381

  Fly   748 S-----------------------TNCGLGLQICTPNMELELGN-NTAAFTNFLASVYKSELILE 788
            |                       .|||.......||...::.. |.|....:|:  |.|...  
Human   382 SEEYFCVKRIFSGGDQSFSHYSSPQNCGPPDDFRCPNPTKQIWTVNEALIQKWLS--YPSGRF-- 442

  Fly   789 PVDIL----ALFSSKEQCDRGYYVQV 810
            ||:|.    ..||| ..|..|.::.|
Human   443 PVEIANEIDGTFSS-SGCLNGSFLAV 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 85/323 (26%)
HERC4XP_011537894.1 RCC1 2..368 CDD:332518 79/293 (27%)
HECTc 733..1079 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.