DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and fin1

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_593305.1 Gene:fin1 / 2542237 PomBaseID:SPAC19E9.02 Length:722 Species:Schizosaccharomyces pombe


Alignment Length:276 Identity:90/276 - (32%)
Similarity:144/276 - (52%) Gaps:23/276 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LANYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVS 166
            :..|:.:..:|.||||.....:|..||..:..|:|:...::...:....:||::...|.|||||.
pombe     1 MEKYKILECIGHGSFGRIYKVQRLKDGALLAQKEIHFGNITRQEKQYIADEVNILRNLKHPNIVQ 65

  Fly   167 YLGSFIKDNTLLIE--MEYADGGTLAQIIAE-RQGKLHFPERYIIAVFEQISSAINYMH------ 222
            |.|..:..:..:|.  |||...|.||.:|.. ::.|..|.|:.::..|.|:..|:...|      
pombe    66 YCGEELNRSAQVINLYMEYCGHGDLANLIQRYKEEKKRFTEQEVLKFFTQLLLALYRCHYGENAP 130

  Fly   223 -------------SENILHRDLKTANVFLNRRGIVKIGDFGISKIM-NTKIHAQTVLGTPYYFSP 273
                         .:::||||:|.||:||:....||:||||:||:: ||::..|:.:|||||.||
pombe   131 ACDSQWPREIFHPKQSVLHRDIKPANIFLDENNSVKLGDFGLSKLLDNTRVFTQSYVGTPYYMSP 195

  Fly   274 EMCEGKEYDNKSDIWALGCILGEMCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSN 338
            |:.....|..|||:|||||::.|:|.|...|...:..||...|..||.:.....|:..:..|:.:
pombe   196 EIIRSSPYSAKSDVWALGCVIFEICMLTHPFEGRSYLELQRNICQGNLSCWDHHYSDDVFLLIRH 260

  Fly   339 LLQVEAPRRPTASEVL 354
            .|:|.:..|||..::|
pombe   261 CLEVNSDLRPTTYQLL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 90/274 (33%)
S_TKc 105..354 CDD:214567 89/271 (33%)
ATS1 445..747 CDD:227511
fin1NP_593305.1 STKc_Nek2 3..281 CDD:270857 90/274 (33%)
S_TKc 4..281 CDD:214567 90/273 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R445
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.