DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and K11D2.1

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001368497.1 Gene:K11D2.1 / 187290 WormBaseID:WBGene00010768 Length:278 Species:Caenorhabditis elegans


Alignment Length:143 Identity:39/143 - (27%)
Similarity:63/143 - (44%) Gaps:19/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 VVSACAGDGFTILVTQAGSLLSCGSNAHLALGQDEQRNYHSPKLIARLADVRVEQVAAGLQHVLA 571
            :|.|.||..|.|.....|:|.|.|:.....||....|....|..|.:|..:|:::||.|..|.:|
 Worm   133 IVEAAAGHDFLIFRDTTGNLFSMGTGTRGELGVGLIRRVDEPVHIEQLVGIRIKKVACGGWHTVA 197

  Fly   572 LSREGAVYVWGTSTCGALG--LGNYQ--------QQQKFPQKILLSHVKTKPSKIYCGPDTSAVL 626
            |:..|..|.||.:..|.||  .|:.:        :::||.::.:|.        :.|....:.::
 Worm   198 LTEGGDAYTWGWNRYGQLGKDKGSTEVYPVLIDPEEEKFGEENILD--------VACTEHNTQIV 254

  Fly   627 FANGEL-HVCGSN 638
            ...|.. .|.|:|
 Worm   255 IKTGHAPFVLGTN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 39/143 (27%)
K11D2.1NP_001368497.1 ATS1 <118..>259 CDD:227511 35/133 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.