DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and Nek1

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001280566.1 Gene:Nek1 / 18004 MGIID:97303 Length:1275 Species:Mus musculus


Alignment Length:254 Identity:112/254 - (44%)
Similarity:167/254 - (65%) Gaps:2/254 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LANYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVS 166
            :..|.:::.:|:||||.|:|.:...||...|.|:||:|.:|...|..:..||.|.:.:.|||||.
Mouse     1 MEKYVRLQKIGEGSFGKAVLVKSTEDGRHYVIKEINISRMSDKERQESRREVAVLANMKHPNIVQ 65

  Fly   167 YLGSFIKDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHRDL 231
            |..||.::.:|.|.|:|.:||.|.:.|..::|.| |.|..|:..|.||..|:.::|...|||||:
Mouse    66 YKESFEENGSLYIVMDYCEGGDLFKRINAQKGAL-FQEDQILDWFVQICLALKHVHDRKILHRDI 129

  Fly   232 KTANVFLNRRGIVKIGDFGISKIMNTKIH-AQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILG 295
            |:.|:||.:.|.|::|||||::::|:.:. |:|.:|||||.|||:||.|.|:||||||||||:|.
Mouse   130 KSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLY 194

  Fly   296 EMCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVL 354
            |:|.||..|.|.|:..||.||::|::.||...|:..||||:|.|.:.....||:.:.:|
Mouse   195 ELCTLKHAFEAGNMKNLVLKIISGSFPPVSPHYSYDLRSLLSQLFKRNPRDRPSVNSIL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 112/252 (44%)
S_TKc 105..354 CDD:214567 111/249 (45%)
ATS1 445..747 CDD:227511
Nek1NP_001280566.1 STKc_Nek1 3..258 CDD:270858 112/252 (44%)
S_TKc 4..258 CDD:214567 112/251 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D132059at33208
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.