DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and NEK10

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001381899.1 Gene:NEK10 / 152110 HGNCID:18592 Length:1172 Species:Homo sapiens


Alignment Length:437 Identity:117/437 - (26%)
Similarity:194/437 - (44%) Gaps:71/437 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 QMPNRQESLLQLSVPRETGVGVAGPELANYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSE 140
            |:....||:.|...|.:        .:.||..:..:|.|:||.....|:.|..:.:..|::||. 
Human   498 QIAENIESINQNKAPLK--------YIGNYAILDHLGSGAFGCVYKVRKHSGQNLLAMKEVNLH- 553

  Fly   141 LSPP-GRDL---------AMNEVDVF-SKLHHPNIVSYLGSFIKDNTLLIEMEYADGGTLAQIIA 194
             :|. |:|.         .::|:.:. .:|:|||||.|..:|::::.|.|.||..:|..|.:..:
Human   554 -NPAFGKDKKDRDSSVRNIVSELTIIKEQLYHPNIVRYYKTFLENDRLYIVMELIEGAPLGEHFS 617

  Fly   195 ERQGK-LHFPERYIIAVFEQISSAINYMHSE-NILHRDLKTANVFLNRRGIVKIGDFGISKIMNT 257
            ..:.| .||.|..:..:|.|:..|:.|:|.| .|:||||...|:.|..:..|.:.|||::|....
Human   618 SLKEKHHHFTEERLWKIFIQLCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVTVTDFGLAKQKQE 682

  Fly   258 KIHAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCCLKKTFAASNLSELVTKIMAGNYT 322
            .....:|:||..|..||:.:.:.|..|:|:||:||||.:|..|...|.::|:..|.|||:...|.
Human   683 NSKLTSVVGTILYSCPEVLKSEPYGEKADVWAVGCILYQMATLSPPFYSTNMLSLATKIVEAVYE 747

  Fly   323 PVPSG-YTSGLRSLMSNLLQVEAPRRPTASEVLVYWIPLIFRSLGKNKGYSYEDDVGGPGSDQLT 386
            |||.| |:..:...:|..|..:|..||...||         .|:..:....|.|::         
Human   748 PVPEGIYSEKVTDTISRCLTPDAEARPDIVEV---------SSMISDVMMKYLDNL--------- 794

  Fly   387 APVPAAAYSNVSMELELPTAQTETKQ-LMIAD----------TAAPHEILEKRSVLYQLKAFGTC 440
                  :.|.:|:|.:|...:..|:: .|.|:          ....||..||.|:........:.
Human   795 ------STSQLSLEKKLERERRRTQRYFMEANRNTVTCHHELAVLSHETFEKASLSSSSSGAASL 853

  Fly   441 FS--MAPIQLPPKAV----------IVDVAMSDSHFVVVNEDGSAYA 475
            .|  .....|||:..          ..|..:||.:|.:.|.:...|:
Human   854 KSELSESADLPPEGFQASYGKDEDRACDEILSDDNFNLENAEKDTYS 900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 87/268 (32%)
S_TKc 105..354 CDD:214567 85/262 (32%)
ATS1 445..747 CDD:227511 9/41 (22%)
NEK10NP_001381899.1 ARM 209..251
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 855..875 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 898..954 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.