DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and NEK7

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_016855833.1 Gene:NEK7 / 140609 HGNCID:13386 Length:310 Species:Homo sapiens


Alignment Length:297 Identity:103/297 - (34%)
Similarity:160/297 - (53%) Gaps:38/297 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 ETGVGVAGP------------------ELANYEKVRVVGQGSFGIAILYRRKS--DGHQIVFKQI 136
            |...|:.||                  .|||:...:.:|:|.|  :.:||...  ||..:..|::
Human     3 EQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQF--SEVYRAACLLDGVPVALKKV 65

  Fly   137 NLSEL-SPPGRDLAMNEVDVFSKLHHPNIVSYLGSFIKDNTLLIEMEYADGGTLAQIIA------ 194
            .:.:| ....|...:.|:|:..:|:|||::.|..|||:||.|.|.:|.||.|.|:::|.      
Human    66 QIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKFLFLIF 130

  Fly   195 ----ERQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKTANVFLNRRGIVKIGDFGISKIM 255
                ::|.:| .|||.:...|.|:.||:.:|||..::|||:|.||||:...|:||:||.|:.:..
Human   131 KKHFKKQKRL-IPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFF 194

  Fly   256 NTK-IHAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCCLKKTFAAS--NLSELVTKIM 317
            ::| ..|.:::|||||.|||......|:.|||||:|||:|.||..|:..|...  ||..|..||.
Human   195 SSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIE 259

  Fly   318 AGNYTPVPSG-YTSGLRSLMSNLLQVEAPRRPTASEV 353
            ..:|.|:||. |:..||.|::..:..:..:||..:.|
Human   260 QCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 97/267 (36%)
S_TKc 105..354 CDD:214567 96/266 (36%)
ATS1 445..747 CDD:227511
NEK7XP_016855833.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R445
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.