DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and RCC1

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001041659.1 Gene:RCC1 / 1104 HGNCID:1913 Length:452 Species:Homo sapiens


Alignment Length:419 Identity:93/419 - (22%)
Similarity:162/419 - (38%) Gaps:97/419 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 GPG-SDQLTAPVPAAAYSNVSMELELPTAQTETKQLMIADTAAPHEILEKRSVLYQLKAFGTCFS 442
            ||. .||.|.||...::| ....|.|...|.:..||.:.:     .::|::             .
Human    45 GPSPPDQKTRPVSHRSHS-TEPGLVLTLGQGDVGQLGLGE-----NVMERK-------------K 90

  Fly   443 MAPIQLPPKAVIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGL-TALEAWKHYPSRMESVRNYH 506
            .|.:.:|..  :|.......|.|.:::.|..|::|....|.||. |::|..:..|.::|....  
Human    91 PALVSIPED--VVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEK-- 151

  Fly   507 VVSACAGDGFTILVTQAGSLLSCGS----NAHLALGQDEQRNYHSPKLIARLADVRVEQVAAGLQ 567
            ||...|||..|..:|..|.:...||    |..:.|.:..::   |...:....||.|.:||:|..
Human   152 VVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKK---SMVPVQVQLDVPVVKVASGND 213

  Fly   568 HVLALSREGAVYVWGTSTCGALG--------LGNYQQQQKF--PQKILL------SHVKTKPSKI 616
            |::.|:.:|.:|..|....|.||        .|..|..::.  |:.::|      .||:.:.:  
Human   214 HLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDA-- 276

  Fly   617 YCGPDTSAVLFANGELHVCGSNDYNKLGFQRSAKITAFKKVQLPHKVTQACF---------SST- 671
            :||...:..:...|.::..|.::|::||...                |::||         :|| 
Human   277 FCGAYFTFAISHEGHVYGFGLSNYHQLGTPG----------------TESCFIPQNLTSFKNSTK 325

  Fly   672 ----------HSVFLVEGGYVYTMGRNAEGQRGI-RHCNSVDHPTLVDSVKSRYIVKANCSDQCT 725
                      |:|.:...|..|::||...|:.|: ........|||:..:.:  :....|.....
Human   326 SWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPA--VSSVACGASVG 388

  Fly   726 IVASEDNIITVWGTRNGLPGIGSTNCGLG 754
            ...::|..:..||.        .||..||
Human   389 YAVTKDGRVFAWGM--------GTNYQLG 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 74/343 (22%)
RCC1NP_001041659.1 RCC1 66..113 CDD:278826 11/66 (17%)
RCC1 116..165 CDD:278826 16/50 (32%)
RCC1 168..218 CDD:278826 13/52 (25%)
RCC1 221..286 CDD:278826 14/66 (21%)
RCC1 289..340 CDD:278826 12/66 (18%)
RCC1 343..386 CDD:278826 10/44 (23%)
RCC1 394..445 CDD:278826 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.