DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and RCBTB2

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_016875858.1 Gene:RCBTB2 / 1102 HGNCID:1914 Length:561 Species:Homo sapiens


Alignment Length:435 Identity:106/435 - (24%)
Similarity:176/435 - (40%) Gaps:61/435 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 FGTCFSMAPIQLPPKAVIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMES 501
            |..| |...:||..:|.:...|.::..:..||::  .:..|....|.|||..:::... |.|::|
Human    44 FSLC-SEEELQLIRQACVFGSAGNEVLYTTVNDE--IFVLGTNCCGCLGLGDVQSTIE-PRRLDS 104

  Fly   502 VRNYHVVSACAGDG-FTILVTQAGSLLSCGSNAHLALGQDEQRNYHSP-KLIARLADVRVEQVAA 564
            :....:.....|.| ..:|.|..|.:.:.|.||:..||.....:...| .:...|::.:|.:||.
Human   105 LNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVAC 169

  Fly   565 GLQHVLALSREGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKTKPSKIYCGPDTSAVLFAN 629
            |..|.|.|:.:|.|:.||.:..|.:|.|: ...|..|:::...........|.||......:...
Human   170 GSYHSLVLTSDGEVFAWGYNNSGQVGSGS-TVNQPIPRRVTGCLQNKVVVTIACGQMCCMAVVDT 233

  Fly   630 GELHVCGSNDYNKLGFQRS------AKITAFKKVQLPHKVTQACFSSTHSVFLVEGGYVYTMGRN 688
            ||::|.|.|...:||...|      .::.|.:.:    :|.:......|::.|.:.|.||..|.|
Human   234 GEVYVWGYNGNGQLGLGNSGNQPTPCRVAALQGI----RVQRVACGYAHTLVLTDEGQVYAWGAN 294

  Fly   689 AEGQRGIRHCNSVDHPTLVDSVKSRYIVKANCSDQCTIVA-SEDNIITVWGTRNG----LPGIGS 748
            :.||.|..:.::..:||.|...|.|.|..|.|....|..| ::...:.:||...|    ||.:..
Human   295 SYGQLGTGNKSNQSYPTPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYMWGQCRGQSVILPHLTH 359

  Fly   749 TNCGLGLQIC--TPNMELELGNNTAAFTNFLASVYKSELILEPVDILAL-------FSSKEQCDR 804
            .:|...:..|  ||.:...|                  |.:||.|.|.:       |.:.:..|.
Human   360 FSCTDDVFACFATPAVTWRL------------------LSVEPDDHLTVAESLKREFDNPDTADL 406

  Fly   805 GYYVQVHDVYPLAHSVLV----------LVDTTTPLISSYEGDYP 839
            .:.|....:|  ||.||:          |.|....::...|..||
Human   407 KFLVDGKYIY--AHKVLLKIRCEHFRSSLEDNEDDIVEMSEFSYP 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 80/314 (25%)
RCBTB2XP_016875858.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.