DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and nek5

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_005172616.3 Gene:nek5 / 101885992 -ID:- Length:244 Species:Danio rerio


Alignment Length:242 Identity:111/242 - (45%)
Similarity:157/242 - (64%) Gaps:5/242 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LANYEKVRVVGQGSFGIAILY-RRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIV 165
            :..||.:|.:|||:||.|:|. ||:.|....|.|:|:|::||...::.:..||.:.||:.|||||
Zfish     2 MERYEVIRQIGQGAFGKALLVKRRRGDEQLYVIKEISLTQLSARDKEASRKEVTLLSKMKHPNIV 66

  Fly   166 SYLGSFIKDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHRD 230
            ::..||...|.|.|.|||.|.|.|...|..::|| .|.|..|:..|.|:...:.::|...|||||
Zfish    67 AFHESFYDRNRLYILMEYCDSGDLMNRIKMQRGK-PFSEAQIVDWFVQMCLGLKHIHDRKILHRD 130

  Fly   231 LKTANVFLNRRGI-VKIGDFGISKIMNTKIH-AQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCI 293
            :|..||||.|.|: ||:|||||::::|:.:. .:|.:|||||.|||:||.|.|:||:|||:|||:
Zfish   131 IKAQNVFLTRGGLKVKLGDFGIARMLNSTMELVKTCVGTPYYLSPEICENKPYNNKTDIWSLGCV 195

  Fly   294 LGEMCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLL 340
            |.|:|.|:..|..|:|.:||..|..|.:.||...|:|.|| ||.|||
Zfish   196 LYELCTLRHPFEGSSLKQLVLCICGGRFRPVSERYSSELR-LMLNLL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 111/240 (46%)
S_TKc 105..354 CDD:214567 111/239 (46%)
ATS1 445..747 CDD:227511
nek5XP_005172616.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D132059at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.