DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and si:ch73-122k23.1

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_021333767.1 Gene:si:ch73-122k23.1 / 101885338 ZFINID:ZDB-GENE-160113-35 Length:347 Species:Danio rerio


Alignment Length:38 Identity:13/38 - (34%)
Similarity:20/38 - (52%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 MAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVL 354
            |.|....:...|:..||.|:|.:|..:...||:|.|:|
Zfish    19 MKGTIPHISESYSKELRELISQMLSCDPKDRPSAEEIL 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 13/38 (34%)
S_TKc 105..354 CDD:214567 12/36 (33%)
ATS1 445..747 CDD:227511
si:ch73-122k23.1XP_021333767.1 PKc_like <19..61 CDD:328722 13/38 (34%)
ApoL 33..297 CDD:310219 10/24 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.