powered by:
Protein Alignment niki and si:ch73-122k23.1
DIOPT Version :9
Sequence 1: | NP_651293.1 |
Gene: | niki / 42959 |
FlyBaseID: | FBgn0045980 |
Length: | 841 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021333767.1 |
Gene: | si:ch73-122k23.1 / 101885338 |
ZFINID: | ZDB-GENE-160113-35 |
Length: | 347 |
Species: | Danio rerio |
Alignment Length: | 38 |
Identity: | 13/38 - (34%) |
Similarity: | 20/38 - (52%) |
Gaps: | 0/38 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 317 MAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVL 354
|.|....:...|:..||.|:|.:|..:...||:|.|:|
Zfish 19 MKGTIPHISESYSKELRELISQMLSCDPKDRPSAEEIL 56
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.