DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and nek11

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_009290854.1 Gene:nek11 / 101883026 ZFINID:ZDB-GENE-100922-73 Length:604 Species:Danio rerio


Alignment Length:250 Identity:95/250 - (38%)
Similarity:138/250 - (55%) Gaps:8/250 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VGQGSFGIAILY---RRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVSYLGSFI 172
            :|:||||...|.   :..::....|.|:|.:.:|.|.....|..|..:.|:|.||.|:.:..||:
Zfish    37 LGKGSFGTVYLVKDTKAVAEERLKVLKEIPVGDLKPNETVHATQEAQLLSQLSHPAILKFYSSFL 101

  Fly   173 KDNTLLIEMEYADGGTLAQIIAE--RQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKTAN 235
            :.:...|..|:.:...|...:.|  ..||. ..|..:.....|:...::|:|...|||||||..|
Zfish   102 ERDAFCIITEFCEDKDLDCKLEELKHTGKT-LSEPQVCEWLCQLLLGVHYIHQRRILHRDLKAKN 165

  Fly   236 VFLNRRGIVKIGDFGIS-KIMNTKIHAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCC 299
            :|| |:.||||||||:| .:|.:...|.|..|||||.|||....|.||:|||||:|||||.||||
Zfish   166 IFL-RKNIVKIGDFGVSCFLMGSCDLATTFTGTPYYMSPEALSHKGYDSKSDIWSLGCILYEMCC 229

  Fly   300 LKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVL 354
            |...|.|.|...:|.:|:.|....:|..|:..|.|||.::|:.::..|.:|::.|
Zfish   230 LAHAFEAQNFLAVVLRIVEGPTPSLPETYSRQLNSLMQSMLEKDSSHRISAADAL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 94/249 (38%)
S_TKc 105..354 CDD:214567 94/248 (38%)
ATS1 445..747 CDD:227511
nek11XP_009290854.1 PKc_like 30..289 CDD:304357 94/249 (38%)
S_TKc 31..289 CDD:214567 94/249 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D132059at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.