DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and nek5

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_002936777.2 Gene:nek5 / 100497645 XenbaseID:XB-GENE-1012494 Length:931 Species:Xenopus tropicalis


Alignment Length:347 Identity:128/347 - (36%)
Similarity:202/347 - (58%) Gaps:34/347 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 YEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVSYLG 169
            |:.||::|:|:||.|.|.:.|||..|.|.|:||||::....::.:..||.:.:|:.|||||::..
 Frog     9 YDIVRMIGEGAFGKAYLAKGKSDNMQCVIKEINLSKMPTKEKEASHKEVVLLAKMKHPNIVTFFS 73

  Fly   170 SFIKDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKTA 234
            |..:.|.|.|.|||.|||.|.:.:.:::|.| |.|..|::.|.|||..:.::|...:||||:|..
 Frog    74 SIEERNKLYIVMEYCDGGDLMKRVNKQRGVL-FEEDQILSWFVQISLGLKHIHDRKVLHRDIKAQ 137

  Fly   235 NVFLNRRG-IVKIGDFGISKIMNTKIH-AQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEM 297
            |:||:..| :.|:|||||::::|..:. |:|.:|||||.|||:||.|.|:||:|||:|||:|.|:
 Frog   138 NIFLSNNGTLAKLGDFGIARMLNNTMELARTCVGTPYYLSPEICENKPYNNKTDIWSLGCVLYEL 202

  Fly   298 CCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVLVYWIPLIF 362
            |.||..|.||:|.:||.||..|.|.|:|:.|:..||.|:|.|.::.:..||:.:.:|..  |.:.
 Frog   203 CALKHPFEASSLRQLVLKICRGRYEPIPTKYSYDLRILVSQLFKISSRDRPSINSILKK--PFLE 265

  Fly   363 RSLGKNKGYS-YEDDVG-------GPGSDQLTAPVPAAAYSNVSMELELPTAQTE---TKQLMIA 416
            :.:.|:.... .|::..       .|.|:....|....         :||.|:.|   .::..|.
 Frog   266 KRINKHLSPELIEEEFSHTVIHRKKPSSNPARYPCKPK---------QLPVAKVEVAKAERCKIR 321

  Fly   417 DTAAP---------HEILEKRS 429
            :..:|         .|:|.||:
 Frog   322 EVNSPKPKVAVQPRREVLPKRN 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 112/255 (44%)
S_TKc 105..354 CDD:214567 111/250 (44%)
ATS1 445..747 CDD:227511
nek5XP_002936777.2 PKc_like 8..264 CDD:389743 113/257 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D132059at33208
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.