DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and herc1

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_017947876.1 Gene:herc1 / 100493988 XenbaseID:XB-GENE-1002062 Length:4854 Species:Xenopus tropicalis


Alignment Length:260 Identity:80/260 - (30%)
Similarity:128/260 - (49%) Gaps:8/260 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 SDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVSACAGDGFTILVTQAG 524
            ||.|.:.:.|.|..::||:|.:|:||....:..:. |.::|:::...||....|...:.:||..|
 Frog  4083 SDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRR-PRQIEALQGEEVVQMSCGFKHSAVVTADG 4146

  Fly   525 SLLSCGSNAHLALGQDEQRNYHSPKLIARLADVRVEQVAAGLQHVLALSREGA-VYVWGTSTCGA 588
            .|.:.|:..:..||.....|...|:.:..|..:.:.|||.||.|.||:|.:|: |:.:|....|.
 Frog  4147 KLFTFGNGDYGRLGLGNTSNKKLPERVTALEGLHIGQVACGLNHTLAVSADGSLVWAFGDGDYGK 4211

  Fly   589 LGLGNYQQQQKFPQKI-LLSHVKTKPSKIYCGPDTSAVLFANGELHVCGSNDYNKL--GFQRSAK 650
            ||||| ...:..|||: :|..:..|  |:.||...|..|..:|.::..|.:....|  |..|:..
 Frog  4212 LGLGN-STAKSSPQKVDVLCGIGIK--KVACGTQFSVALTKDGHVYTFGQDRLIGLPEGRARNHN 4273

  Fly   651 ITAFKKVQLPHKVTQACFSSTHSVFLVEGGYVYTMGRNAEGQRGIRHCNSVDHPTLVDSVKSRYI 715
            ......|.|...:......:.|::.|...|.||..|.|:|||.|:.|.|.|..||||.:::.:.|
 Frog  4274 RPQLVPVLLGIFIDDIAVGAEHTLALSASGEVYAWGSNSEGQLGLGHTNHVREPTLVTALQGKNI 4338

  Fly   716  715
             Frog  4339  4338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 80/260 (31%)
herc1XP_017947876.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.