DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and herc6

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_031759089.1 Gene:herc6 / 100487734 XenbaseID:XB-GENE-968556 Length:1030 Species:Xenopus tropicalis


Alignment Length:396 Identity:106/396 - (26%)
Similarity:164/396 - (41%) Gaps:61/396 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 VAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYH---VVSACAGDGFTI 518
            |:..:.|.:.:.|||:..:.|:..:||||.      |...|.:|.:.:..   :|....|...::
 Frog    39 VSCGEKHTLYLLEDGTLLSCGQNPYGQLGR------KSNNSSIEQISSLEAQTIVDISCGTNHSV 97

  Fly   519 LVTQAGSLLSC--GSNAHLALGQDEQRNYHSPKLIARLADVRVEQVAAGLQHVLALSREGAVYVW 581
            .|:..||:.|.  ||...|..|....||: :||.|..|.:.::.|::.|..|.||||.:|.|:.|
 Frog    98 AVSDEGSIYSWGDGSEGQLGTGNLSSRNF-TPKKITGLFNTKIIQISCGNFHSLALSEDGRVFSW 161

  Fly   582 GTSTCGALGLGNYQQQQKFPQKILLSHVKTKP-SKIYCGPDTSAVLFANGELHVCGSNDYNKLGF 645
            |.:.||.||||:....|..||  |:..:|..| .::..|...|..|..:|.:...|.|:..:|||
 Frog   162 GQNKCGQLGLGSQIINQATPQ--LVKSLKGIPLVQVTAGGSQSFALSMSGTVFAWGKNNAGQLGF 224

  Fly   646 QRS-AKITAFKKVQLPHKVTQ---------ACFSSTHSVFLVEGGYVYTMGRNAEGQRGIRHCNS 700
            :.. .|...||    ||.|..         :| ...|:..|.:.|.|||.|.:..||.|....|.
 Frog   225 KSDPMKAGTFK----PHAVNSLRNLGVAYISC-GEEHTAVLSKDGSVYTFGDDTHGQLGQNSGNQ 284

  Fly   701 VDHPTLVDSVKSRYIVKANCSDQCTI--VASEDNIITVWGTRNGLPGIGSTNCGLGLQICTPNME 763
            ...|..::....: :.:..|....|:  |.|.:.|::.        |.||.......: |:...|
 Frog   285 TSVPQKIEDYAGQ-VSQVACGRYHTLLYVFSCNRIVSF--------GKGSLRPQDNTE-CSDEAE 339

  Fly   764 L--ELGNNTAAFTNFLASVYKSELIL-EPVDILALFSSKEQCDRGYYVQVHDVYPLAHSVLVLVD 825
            |  |...::...||.|..||...:.. ..|.....||.:|...|                .:|.|
 Frog   340 LPSEFDISSLVPTNDLRDVYVKWIFAGNNVGFAVPFSQQEATKR----------------TLLSD 388

  Fly   826 TTTPLI 831
            |..|::
 Frog   389 TFKPIL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 86/307 (28%)
herc6XP_031759089.1 ATS1 2..373 CDD:227511 98/357 (27%)
HUL4 324..1021 CDD:227354 20/88 (23%)
HECTc 684..1028 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.