DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and LOC100486125

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_002933706.3 Gene:LOC100486125 / 100486125 -ID:- Length:550 Species:Xenopus tropicalis


Alignment Length:256 Identity:99/256 - (38%)
Similarity:149/256 - (58%) Gaps:4/256 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LANYEKVRVVGQGSFGIAILYRRKSD-GHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIV 165
            :..|.....:|.|||..|.|.....| |||.|.|:|....:.|.....:..|..:...|.||.||
 Frog    26 MGRYNIHHTLGSGSFATAYLVTDAKDAGHQKVLKRIPCEGMKPDATLPSAREAKLLGSLRHPFIV 90

  Fly   166 SYLGSFIKDNTLLIEMEYADGGTLAQIIAERQGKLH-FPERYIIAVFEQISSAINYMHSENILHR 229
            .:|.||::.....|..|:.:||.|...|.:::.|.. |||.:::..|.|:...:||:|...||||
 Frog    91 RFLSSFLEKEDFCIITEFCEGGDLQNRIQKQREKSQLFPEEHVMEWFIQLLLGVNYLHERLILHR 155

  Fly   230 DLKTANVFLNRRGIVKIGDFGISKIMNTKIH-AQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCI 293
            |||:.|:|| :.|.|||||||:|:|::.... |.|..|||:|.|||:.|...|:.|||||:||||
 Frog   156 DLKSKNIFL-KNGTVKIGDFGVSRILSMPSDMATTFTGTPHYMSPEVLEHYGYNAKSDIWSLGCI 219

  Fly   294 LGEMCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVL 354
            |.|:|.|:..:.::|..:||::|:.|....:||.|::.|..::..:|..:..:||:|||:|
 Frog   220 LYEICALRHAYDSANWIKLVSQIVEGPCPSLPSQYSAELNDILKRVLNKDPQQRPSASEIL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 99/254 (39%)
S_TKc 105..354 CDD:214567 98/251 (39%)
ATS1 445..747 CDD:227511
LOC100486125XP_002933706.3 PKc_like 28..285 CDD:419665 99/254 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D132059at33208
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.