DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and herc5.4

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_005160166.1 Gene:herc5.4 / 100148091 ZFINID:ZDB-GENE-090311-7 Length:995 Species:Danio rerio


Alignment Length:377 Identity:86/377 - (22%)
Similarity:154/377 - (40%) Gaps:66/377 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 PIQLPPKAVIVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVS 509
            |::......::.:|..|.|.:.::.||..:.|||.|||||||...:|....|..::|:....|..
Zfish   108 PLKSLENRQVIQIACGDQHSMALSNDGQLFVWGENTHGQLGLRKEQAGTQSPQHLQSLCEIPVAQ 172

  Fly   510 ACAGDGFTILVTQAGSLLSCGSNAHLALGQDEQRNYHSPKLIARLADVRVEQVAAGLQHVLALSR 574
            ..||...:.:::.:|.:...|||:...||..:.::...|.::..|...:...::.|.:|...||:
Zfish   173 ISAGGNHSFVLSLSGVVFGWGSNSAGQLGLGDTKDRFVPTIVKSLCGKKTVSISCGGEHTATLSK 237

  Fly   575 EGAVYVWGTSTCGALGLGNYQQQQKFPQKILLSHVKTKPSKIYCG-------PDTSAVLFANGEL 632
            .|.|:.:|:...|.|| .|..:.:..| :::.....:|.|::.||       .::|.::::.|  
Zfish   238 GGTVFTFGSGGFGQLG-HNSLKDEHHP-RLIAELWGSKVSQVTCGRHHTLVFEESSKLIYSFG-- 298

  Fly   633 HVCGSNDYNKLGFQRSAKITAFKKVQLPHKVT----QACFSSTHSVFLVEGGYVYTMGRNAEGQR 693
              ||..  .:||.....|.:....|.||.:.|    :...:..|..|.:   :....|..:|..:
Zfish   299 --CGMQ--GQLGNGEQVKQSVPLPVLLPTECTEFTMEKLITGEHHSFAL---FFKNPGNESEKPK 356

  Fly   694 -----GIRHCNSVDHPTLVDSVKSRYIVKANCSDQCTIVASEDNIITVWGTRNGLPG-------- 745
                 ||.        ||.|.:..|::.:   ||....|.:|.|  ||:.:...|.|        
Zfish   357 SGSNGGIL--------TLNDRMIDRWVSE---SDPWPTVKNEIN--TVFSSAASLNGSFLKTSRD 408

  Fly   746 ----IGSTNCGLGLQICTPNMELELGNNTAAFTNFLASVYKSELILEPVDIL 793
                ....:|||...:.           ..:|....||   ..||.|.|.::
Zfish   409 EHYQTSVEHCGLDFDLV-----------KTSFAKLFAS---KSLISEVVKVV 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 76/329 (23%)
herc5.4XP_005160166.1 RCC1_2 117..146 CDD:290274 10/28 (36%)
RCC1 133..183 CDD:278826 18/49 (37%)
RCC1 186..235 CDD:278826 10/48 (21%)
RCC1 239..286 CDD:278826 12/48 (25%)
RCC1 294..343 CDD:278826 12/54 (22%)
HECTc 658..993 CDD:294058
HECTc 682..992 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.