DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and rccd1

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_012813982.2 Gene:rccd1 / 100135212 XenbaseID:XB-GENE-877111 Length:411 Species:Xenopus tropicalis


Alignment Length:397 Identity:89/397 - (22%)
Similarity:152/397 - (38%) Gaps:102/397 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 ELVTKIMA-GNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVLVYWIPLIFR---SLGKNKGY 371
            :|:.::.| |.::...|...:....|....:|::.......|:..:.|....:|   .||..:..
 Frog     3 DLIPQVAARGKHSSRDSARITSRERLHLGSIQLDFTASGPRSDPPMPWYGFGYRGFEQLGFGQKL 67

  Fly   372 SYE-------DDVGGPGSDQLTAPVPAAAYSNVSMELELPTAQTETKQLMIADT--AAPHEILEK 427
            |.:       ::...|...::|..|||.:||         ...||...|:::.:  |:||:.|..
 Frog    68 SLDLPEPIQLEEAAAPTDTEVTKAVPAWSYS---------AFVTEDGSLLLSGSIGASPHKYLSF 123

  Fly   428 RSVLYQLKAFGTCFSMAPIQLPPKAVIVDVAMSDSHFVV-VNE-----DGSAYAWGEGTHGQLGL 486
            :.:        .|              |||..::.:.:| :.|     |..|:. .||.|.:   
 Frog   124 KGL--------DC--------------VDVLPTEKYLLVQLKERLQCWDTQAFI-AEGPHAE--- 162

  Fly   487 TALEAWK-HYPSRMES----VRNYHVV----------------SACAGDGFTILVTQAGSLLSCG 530
               ..|| ..||...|    |.|.::|                ....|:...:|:|...::|:.|
 Frog   163 ---PMWKMDLPSAHNSLFPLVTNGYIVPKPPFFRELPSKIHARKLALGNEHAVLLTSELTVLTWG 224

  Fly   531 SNAHLALGQDEQRNYHSPKLIARLADVRVEQVAAGLQHVLALSREGAVYVWGTSTCGALGL---- 591
            :..|..||..:..:...|:::..|..|.:.:||||..|...:|..|.:|.||.:..|.|||    
 Frog   225 AGRHGQLGHGDLEDVEEPQIVDALHGVPMSEVAAGGWHSAGISESGDIYTWGWNESGQLGLPCKT 289

  Fly   592 -------------------GNYQQQQKFPQKILLSHVKTKPSKIYCGPDTSAVLFANGELHVCGS 637
                               |.:...|.||..|.|.. :::.|||.||...:|.:..:|||:..|.
 Frog   290 QQCSVSTKQSHKEDEMGNTGEFITIQAFPALIDLPQ-ESEASKISCGSRHTAAVSRSGELYSWGW 353

  Fly   638 NDYNKLG 644
            ..|.:||
 Frog   354 GKYGQLG 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855 8/48 (17%)
S_TKc 105..354 CDD:214567 7/43 (16%)
ATS1 445..747 CDD:227511 62/250 (25%)
rccd1XP_012813982.2 ATS1 <201..373 CDD:227511 44/161 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.