DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment niki and herc5.3

DIOPT Version :9

Sequence 1:NP_651293.1 Gene:niki / 42959 FlyBaseID:FBgn0045980 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_021330683.1 Gene:herc5.3 / 100073325 ZFINID:ZDB-GENE-070615-14 Length:1002 Species:Danio rerio


Alignment Length:321 Identity:75/321 - (23%)
Similarity:117/321 - (36%) Gaps:95/321 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 IVDVAMSDSHFVVVNEDGSAYAWGEGTHGQLGLTALEAWKHYPSRMESVRNYHVVSACAGDGFTI 518
            ::.:|..|.|.:.:..||..:.|||...|||||                                
Zfish   123 VIQIACGDQHSMALTNDGQLFVWGENALGQLGL-------------------------------- 155

  Fly   519 LVTQAGSLLSCGSNAHLALGQDEQRNYHSPKLIARLADVRVEQVAAGLQHVLALSREGAVYVWGT 583
                                :.||....||:.:..|..:.|.|::||..|...||..|.|:.||:
Zfish   156 --------------------RKEQAGTQSPQHLQSLCGIPVAQISAGGNHSFVLSLSGVVFGWGS 200

  Fly   584 STCGALGLGNYQQQQKFPQKILLSHVKTKPSKIYCGPDTSAVLFANGELHVCGSNDYNKLGFQRS 648
            ::.|.||||:  ...:|...|:.|....|...|.||.:.:|.|...|.:...||..:.:||.   
Zfish   201 NSAGQLGLGD--TTDRFIPTIVKSLSGKKTVSISCGGEHTATLSKGGTVFTFGSGGFGQLGH--- 260

  Fly   649 AKITAFKKVQLPH--------KVTQACFSSTHS-VFLVEGGYVYTMGRNAEGQ--RGIRHCNSVD 702
               .:.|....|.        ||:|......|: ||......:|:.|...:||  .|.:...||.
Zfish   261 ---NSLKDEHHPRLVAELWGSKVSQVTCGRHHTLVFEDSSNQIYSFGCGMQGQLGNGEQVKQSVP 322

  Fly   703 HPTLVDSVKSRYIVKANCSDQCT------IVASEDNIITVW----GTRNGLPGIGSTNCGL 753
            .|.|:.:             :||      ::|.|::...::    |..:..|..|| |.|:
Zfish   323 LPVLLPT-------------ECTEFTMEKLIAGENHSFALFFKSPGNESEKPKSGS-NGGI 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nikiNP_651293.1 STKc_Nek 104..359 CDD:270855
S_TKc 105..354 CDD:214567
ATS1 445..747 CDD:227511 71/313 (23%)
herc5.3XP_021330683.1 RCC1 <74..349 CDD:332518 69/298 (23%)
HECTc 665..1000 CDD:331829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.