DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Saf-B and RS40

DIOPT Version :10

Sequence 1:NP_733041.2 Gene:Saf-B / 42958 FlyBaseID:FBgn0039229 Length:928 Species:Drosophila melanogaster
Sequence 2:NP_194280.1 Gene:RS40 / 828654 AraportID:AT4G25500 Length:350 Species:Arabidopsis thaliana


Alignment Length:291 Identity:65/291 - (22%)
Similarity:117/291 - (40%) Gaps:56/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 SKSGSGSSAGNGTGANSNNKQATLSRNLWVSGL-STLTRASDLKAIFSKFGKVIGAKVVTNTRTP 350
            :||..|....:|.|:..::.....|:.|:|... :..||..||:..|..:||::..::..|    
plant    72 TKSERGGDKRSGGGSRRSSSSMRPSKTLFVINFDADNTRTRDLEKHFEPYGKIVNVRIRRN---- 132

  Fly   351 GTRCYGYVTMSSSADASRCIENLHRTELHGRIISVERTKNEIGGSLNSKEGKGKAPGDAGNKKKE 415
                :.::...:..||:|.::..:.::|..::||||....:     :...|.|.:|     :::.
plant   133 ----FAFIQYEAQEDATRALDASNNSKLMDKVISVEYAVKD-----DDARGNGHSP-----ERRR 183

  Fly   416 DDSGKKSGSGKGSSSNSGDDKKGGD-GNGDSKSVGGDLKRDGKESNRARS--------RRNDDRG 471
            |.|.::.   :.|.|....::...| |.|.|.......:|...:..|.||        |.:.:.|
plant   184 DRSPERR---RRSPSPYKRERGSPDYGRGASPVAAYRKERTSPDYGRRRSPSPYKKSRRGSPEYG 245

  Fly   472 KSLASQDRPRHDRERSAKGSQDHRSGRNPRDVDREIQQRQRERERRQREMLSYQKIREERERQRL 536
            :.....|.||. |||.|..::..||..|                :|:|...::...::|..|..:
plant   246 RDRRGNDSPRR-RERVASPTKYSRSPNN----------------KRERMSPNHSPFKKESPRNGV 293

  Fly   537 RERERELREEERRRREARERQRIEEERLQEE 567
            .|.|..:        |.|||.|...|..|.|
plant   294 GEVESPI--------ERRERSRSSPENGQVE 316

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Saf-BNP_733041.2 SAP 11..42 CDD:460424
2A1904 <16..>270 CDD:273344
RRM_SF 311..386 CDD:473069 17/75 (23%)
SWIRM-assoc_1 <588..618 CDD:465142