DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Saf-B and AT3G46020

DIOPT Version :9

Sequence 1:NP_733041.2 Gene:Saf-B / 42958 FlyBaseID:FBgn0039229 Length:928 Species:Drosophila melanogaster
Sequence 2:NP_190188.1 Gene:AT3G46020 / 823745 AraportID:AT3G46020 Length:102 Species:Arabidopsis thaliana


Alignment Length:97 Identity:30/97 - (30%)
Similarity:56/97 - (57%) Gaps:2/97 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 LSRNLWVSGLSTLTRASDLKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASRCIENLH 374
            :|..|:||.||..|....|:.:||.||::..|:::.::.|...:.:|::|..|..||.:.:::|.
plant     5 ISAQLFVSRLSAYTTDQSLRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKALKSLD 69

  Fly   375 RTELHGRIISVERTKN--EIGGSLNSKEGKGK 404
            ...:.||:|.||..||  |:...:||.:.:.:
plant    70 GKIVDGRLIFVEVAKNAEEVRAGINSNKAEDR 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Saf-BNP_733041.2 SAP 11..42 CDD:280251
RRM 205..>394 CDD:223796 28/85 (33%)
RRM_SAFB_like 313..386 CDD:240863 22/72 (31%)
SWIRM-assoc_1 <588..618 CDD:293104
AT3G46020NP_190188.1 RRM 9..80 CDD:214636 22/70 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.