DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Saf-B and safb

DIOPT Version :9

Sequence 1:NP_733041.2 Gene:Saf-B / 42958 FlyBaseID:FBgn0039229 Length:928 Species:Drosophila melanogaster
Sequence 2:NP_001016713.1 Gene:safb / 549467 XenbaseID:XB-GENE-5873119 Length:135 Species:Xenopus tropicalis


Alignment Length:149 Identity:46/149 - (30%)
Similarity:70/149 - (46%) Gaps:50/149 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEAGKKIAELRVCDLKSELEKRELETVGPKAVLIERLEKSLRAEGLDPATHLIVPGAKAKKPFAM 66
            ||. ||::||||.|||:||:||.::|.|.|:||:|||.|::..||.:|..   :|          
 Frog    18 PEM-KKLSELRVIDLKAELKKRNVDTGGNKSVLMERLRKAIEDEGGNPDE---IP---------- 68

  Fly    67 PMKDLQSEVVIKEEPIDANEEEVKVEQQDDYQNGNDYSHHADDDGHEIDQVGDVDDECVILDDDD 131
                :.|:...|:.|..:.... |:|:.:|  ||.:     ||.|                  |:
 Frog    69 ----VSSDTPSKKTPKRSGRVR-KIEEGED--NGLE-----DDSG------------------DN 103

  Fly   132 EEDEDHVYDDEPQSGDGDA 150
            :|:||      |.:..|.|
 Frog   104 QENED------PGTEQGTA 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Saf-BNP_733041.2 SAP 11..42 CDD:280251 19/30 (63%)
RRM 205..>394 CDD:223796
RRM_SAFB_like 313..386 CDD:240863
SWIRM-assoc_1 <588..618 CDD:293104
safbNP_001016713.1 SAP 23..57 CDD:128789 20/33 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5781
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 307 1.000 Inparanoid score I2591
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005622
OrthoInspector 1 1.000 - - otm48360
Panther 1 1.100 - - LDO PTHR15683
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1765
SonicParanoid 1 1.000 - - X1802
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.180

Return to query results.
Submit another query.