DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Saf-B and tra2b

DIOPT Version :9

Sequence 1:NP_733041.2 Gene:Saf-B / 42958 FlyBaseID:FBgn0039229 Length:928 Species:Drosophila melanogaster
Sequence 2:NP_001006878.1 Gene:tra2b / 448667 XenbaseID:XB-GENE-5864557 Length:293 Species:Xenopus tropicalis


Alignment Length:315 Identity:72/315 - (22%)
Similarity:120/315 - (38%) Gaps:67/315 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 DKSIKSVKPANKSEKSNSKDADKKNDDGARSKKRDEKSGDKKDSSEQKSSGKSSNQKDDKEKSTA 271
            |:..:|...:..:.:|....:...|...|||:.: |.|...:..:..:|..:|.:::..:...| 
 Frog    11 DRESRSASRSGSARQSGKSASQSPNHSAARSRSK-EGSRHSRSKTRSRSDSRSRSRRSSRRHYT- 73

  Fly   272 APGGATSSTAS-SAAGSKSGSGSSAGNGTGANSNNKQATLSRN------------LWVSGLSTLT 323
                 .|.|.| |...|:|.|.|.......::|::..:|..|:            |.|.|||..|
 Frog    74 -----RSRTRSRSRRRSRSRSHSRDYRRRRSHSHSPMSTRRRHVGNRANPDPNCCLGVFGLSLYT 133

  Fly   324 RASDLKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASRCIENLHRTELHGRIISVERT 388
            ...||:.:|||:|.:....:|.:.::..:|.:.:|...:..||....|..:..||.||.|.|:.:
 Frog   134 TERDLREVFSKYGPISDVSIVYDQQSRRSRGFSFVYFENVDDAKEAKERANGMELDGRRIRVDFS 198

  Fly   389 KNEIGGSLNSKEGKGKAPGDAGNKKKEDDSGKKSGSGKGSSSNSGDDK-------KGGDGNGDSK 446
                    .:|......||....:.....|.::....:|......||:       :||.|.|   
 Frog   199 --------ITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGGYDDREYYSRSYRGGGGGG--- 252

  Fly   447 SVGGDLKRDGKESNRARSRRNDDRGKSLASQDRPRHDRERS-----AKGSQDHRS 496
              ||                  .||    .|||.:..|.||     ::||...||
 Frog   253 --GG------------------WRG----GQDRDQFSRRRSPSPYYSRGSYRSRS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Saf-BNP_733041.2 SAP 11..42 CDD:280251
RRM 205..>394 CDD:223796 47/199 (24%)
RRM_SAFB_like 313..386 CDD:240863 23/84 (27%)
SWIRM-assoc_1 <588..618 CDD:293104
tra2bNP_001006878.1 RRM_SF 113..201 CDD:388407 24/95 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1765
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.